%PDF-1.5 % 12 0 obj << /Type /ExtGState /RI /RelativeColorimetric >> endobj 13 0 obj << /Type /OCG /Name >> endobj 14 0 obj << /Type /OCG /Name >> endobj 17 0 obj << /N 3 /Alternate /DeviceRGB /Filter [/FlateDecode] /Length 2594 >> stream xڝwTTϽwz0z.0. Qf Ml@DEHb!(`HPb0dFJ|yyǽgs{.$O./ 'z8WGбx0Y驾A@$/7z HeOOҬT_lN:K"N3"$F/JPrb[䥟}Qd[Sl1x{#bG\NoX3I[ql2$ 8xtrp/8 pCfq.Knjm͠{r28?.)ɩL^6g,qm"[Z[Z~Q7%" 3R`̊j[~: w!$E}kyhyRm333: }=#vʉe tqX)I)B>== <8Xȉ9yP:8p΍Lg kk Ѐ$t!0V87`ɀ2A. @JPA#h'@8 .: ``a!2D!UH 2 dA>P ECqB**Z:]B=h~L2  5pN:|ó@ QC !H,G6 H9R ]H/r Aw( Q(OTJCm@*QGQ-(j MF+ 6h/*t:].G7Зw7 Xa<1:L1s3bXyeb~19 vGĩp+5qy^ oó|= ?'Htv`Ba3BDxHxE$Չ"XAP44077&9$An0;T2421t.54ld+s;# V]=iY9FgM֚k&=%Ō:nc1gcbcfX.}lGv{c)LŖN퉛w/p+/<j$.$%&㒣OdxTԂԑ4i3|o~C:&S@L u[Uo3C3OfIgwdO|;W-wsz 17jl8c͉̈́3+{%lKWr[ $ llGmnacOkE&EEY׾2⫅;K,KhtiN=e²{^-_V^Oo§s]?TWީrjVQ=w}`嚢zԶiו8>k׍ E  [ly邟~_Y53rW򯎼^{7so}x>|쇊z>yz endstream endobj 16 0 obj [/ICCBased 17 0 R] endobj 18 0 obj << /Type /XObject /Subtype /Image /Name /Im259 /Filter [/FlateDecode] /Width 552 /Height 284 /BitsPerComponent 8 /ColorSpace /DeviceGray /Decode [0 1] /Length 27388 >> stream x}"-ZRUZTTk+{o!Vl#3(7^g^Oo{G!y3g<9ϓ!okc"n|݊o$>R|s-PJ_WN.WUl9{{~eZuw֫Yx˗/]dE .X0?2^ PTAKXsnQ7ٴm۷mݲ9v ׭]zUʕ+/f,??rܹs"f_—>M^a揄{m}XB‘Çؿwݻvܱ}۶$k֬A,[^dHȬ3f_ї>n޸;%ە`ҙӧNx;v?u3EՀeK,YxĚyF̞92uɓ&M0әse{Sv:rի/]@K9w6q"njI8r@ЁH HvadFH֮^RHHb:~diS F!'7n§|p޽wܺuW\B?n$#DЋ:h" #wcMaibV6Qa?b@B~dxȨQ#G1/&fI;N߿Ǐ<~Ѐ{w#1(~ˈ ĚǓ'#7 ];"k6mXhc_H@B2{,5 F"Ç6,0/Ly9~ӱn<t<~ܿoɝH PILX!9z@1وq#T6#@,"D`:cp###BC:dN2^?q'qcR e/gFvcj H\$׮]CY+\#6)8#aC H׷1%fɕCۮyϟ, yYD0иqӠ5W@ 1< bVWM1aƠ#|Yi`[O6$Fli ~d& @ݫW=YK=_~g 0y5& wW- 0č\z͠ " $%M8|Dv#&ɺ{52~5h@$@Gp (l02֑&'hc@2h#5 ݳgݻwoV_p;O~n/D?gyĵ=A)x)\!ElRj 7SX>V²1\#>xS܌HLJ21bI/H FuڥKqVr#)? ~;9 H0]e7rB*x 0 <.Ar 5l=_lFc=FAx嘲HF̉ATD <Rxࠁ`sΝ:O\&۵B{H=ǹV 2#D8U5Wx14k2P&%CF3[b6m)6n˖-&5Iʎvٳw߾}?tacQl/Ak M7YjKC74s>zo`PS{HGўPkǔGLj5;}t)W}{,{"2_}Nc#2nH@Ђ.e9 VJ̅ 1}0&wYczU0xFO7k7,7o!;Rx5w eyCy\4npq'?Q &!<$V@b{ 7gȱP!J+|@ Dz1?cl};}:uήO\v&. VȵoA#ܹE)+8FCj "z}~=[07B|]^zs*OW:^1֭9zU zo 0CAGX.]u?cRj;b ; y<@SgvI9\B!o0Br#]b-_,!;'njWdN?8\a1Q6vhWo{3^X>n}[?L=}H(PzgX`yH\s Z9@ُ%KNoӯB8b[M!7Uzޛ .E|D}SЯ<}Ȁ߽_7 GdGCMy(_f$Gqq,Y ԯf{ΔKV|"_(zM5)U19t29Ÿ2:uu<;5J@"]LS' &sbGiݱ7L/u }h"iSI9#Xۯ?aKᣗ$ћbYJCIL:a՛w>~"7t 6H< /-1!4sB:zUDi:U[鉓:Zp NM:N#vƚ8h`+^F GO|5DiykW; &br %]s kgT8/RMp0.;miCpL섾}I0Qd] YN(.#̨{]"Y+j1‡hr`8;SgArG[ 1%֝w4JnښF-Dhv,K[tv_w={qvЏwAB3k0H0uێ{:r4:_8t$ktd)ɥu\(d\ GHxdx(5r&]?{m޾qT=>JaJ7Z8q8t*Eqt+xX' KYh3f/3#f#To1)a2׹pkހAhhXذ#L2}Q+W3'e7o۾k ŠcN'q]721(u"9q!z~qUfT='>pЁ}{wܾmX4 G[7 I7Zd6o…,ւm#n0g7}:t[@̋!L'Q6D'N`Ђ%Pi>|Fo|͌sG-]f=n71P:|ѤkaܣuL&VWϤ\yӟ$1f)Hz`{ڥ䓉 e@ACpe ƀďj!Ǡ>ټ)p1ε@c'k7z^)GTfe&ayWpa*AT=QbD#J0DAɈq`c0BM>sNdT/ǭFŜ#kyTF$A}>ზ)v3'>`5nBj~#Ъ.,67Z4Y& P6ˬƀFXad'( X4\/ V+G/^| r#$((&DЙ1j 5s`.v⒵;޾Sp[<e |Isϟ=}ء}1֮H IJeX6DԼ-^Ęh@a]hV j޸B8!DžF &a 1Z9g6 ;&L0> qQxsgNz2Y lp#ژeQgO85<A)SN6LFe(Fypz]C—7]9z&s;y y֥3vn^ ò$/@!D@$VDYa-0{6Q4`(Gfb+"3ш?% ; !`0d[O, j63Oj%]d~Ic0mMo$?iӦ@b3x)߸ً,]j톸-w(!3g_D\y, n]4xhh2{μ !>%P,"f1u% Pƃ_w/c GǬXx 2eD.Y`)gO&_tet ȑc%!ä؁Ñ v?eq £~~Z,V*{[ 4h!CE-KG;~3+$i1 qjWrk֮BK@d+d/̺ɱvĭYhBmgʁzFiҥ1qLM|ɢs?Ô ۲C ̚6ex!Frb*|8u$FI%mPa0ѱc X'٩SΝ: ^dw3#>|Ν;{_ҽ֥b\Ph a"cD]b*WHQ,fw1x`N#] dv&#8CIw,osGOHf,_k-'kW\dy3M̙ zu{v߼~eS'tto{GXգE{cګ!@9`#>d~ku\tꈠPzR#ghh  B9zi3.X|e* Ap1XW8Z+D_l\D= cѣIIq(r|CO2x?"=e`Rs{'&xĭmBb,2Nd;!C BFNڵi݊um5֎5u4;0\Sҵsc؋tbL`ߡ/^_4?RR(0F>lgD#4|HS$Ɉ%d~b+ZR`&a ~NNLhg0 M@$_f}Fn&[>_%nIcp;n\S!{(g⭆~}zvک}-7k֬y-Zk? V!X.lڹRRc:1tb'b=EQٞ`DD>Kѹp?Z$I2d1v̹.!1}rLT9uv iL[;}h9S'1Rň~7@c'nqcG۹u51ы"#f`"m(Jзg۴jѬ XSIS1A E M+ Yr2x.]{q=! ˆ/̸Ow -g)9]#vKчhh`GsWRg ΁<ơ<Dn;>_%#!RJ0Ƹ߱{ I'޿3n]r93cA{uԮU&5Dk԰ Xi!hiɱHPN6mzL;b:=/_W Ha,>R0IFܘ1Ə7u>q3ʀ.F7j vmDm(j+n4Ǐ[7o^xXeͪ10K5k(x@1I,s,pJa:9տl>dҌYs]58eރGٶ~yȈ{0m cЫKV7l5kD`iBhAc0 ##S+_6 $6ss`*>?ckk+V1T R@BkپC >j N'(jRHL׬]aSQeݨm սAo?,v򎻿 ǎJNxYfR D֬'&Aa`:LDJVצs߰O6sN¨e7nݱ}UΚ<80eӧLҧkVM5Wc7ob Fhֻi֌/v2-m*#Qc7iG #B!X 0DJv;vڣw 7EʄS 6x$#Jh^,HU׻v"FMGǒN9w(ҩ"ir$";$0Ն,bZ杻7pI'L5 fc+wL;|H4kZIm;CGO>+"b4jN6ܯ{MC$QL6oۏb=ڵk᧠/piкAMT92npBp]&5 ֎i۾C]0qCvɍ1塋` hϜ-A| i)%tiOxf2Νw7F_9vٔKWXi]႞ B=cB`+d[rUcFM[6rIzM?zؠ:lT 6=szl.cj70>BI?^Lc~WlWt 8hP0|8a4Y0 s@2RRg<\4hYݸڅmx BN1C$5"fNH:y6 ,WpOau9d]#9~*|^roj5jӭaaBٵ]u~#?@XVj~_ > B_@R€_/Š5Fn"TMdбS}7$X6Z*mjQ8\fMGظq&L8 W- %8e `YMy {&cټs:DŽGASȅrˉ$LNA5kt]Zd ҟDRcB^{-(>G2Xftұm˦k׬7Ս}0V̂{r5k|V^ Sa`0zN[4vJ%-Lk} CWz0ЯzG,Bm%Æq&Nv !Ф3i؍8㴜o&XAH{%޿`/"Tاܥ] _~z޷)^UL4Uz/+}QʕTZ믫U @ż}gw3YAEF\jAr0\%o`Rߩ Pژ*UYppG( xO@`Ш} `!s#E Z-^еL8C'pbʉ Msa, i/#N{"~@HqU_eWJ [i/nXɮlj,ok 5P 4? g8,`IeWƬ^ 0T o np"%&3P)ٲ!TP+nMV+ξKI4`c%U\ S\;e$FIGzu뜮 A&fv E^ݢ$pUo@^K&Cx`V^Ռa"c C`.-jLR05U87 .+!С8@:t+8fM4'6 u3U}L$T:+WQ>h}¨`SpkjƥO JvpnKR T{8'ÏW{q\\GJ3'F$Y qNʴ615 4(K \hӑz0#e!fh(&cƱz}OWtDB6'DT9|0ڑJg'at ލaDHp,aT@̈́T)ij.PLBu ]Ja$kGqxwaDػe<Xq]D 3B~~Q0#\uMI(ɅtLΙtr+b.9杢TWҾsByaHރńvߐR;Ɨ#ljL0n|>C';&Ȓ1bHT0"G&J A W  ؝V +ZH$]OQ0ډVIh"3R:6Cu3,lУTB,{$Nسԑn=K]{b % ٱHP \Ѿ GՌQlQ H ` bYThw)l-̈́3A+bLa#,uHB^%xjZLHS%kȿ` Boh7FN$IHN@jZ_< T^&bq+pm[@1X%oуNϹJ0X`ah"ꟼW/74i@ %stK\3scIIPPN+-4-3ǸY]$0}Y?JDzd$ yڞ#CHRd-BP/Q4M@4??h xֱѱn|<گXH R[(#W `ab-[%V4Xfi !qwm|rܞu#EїRA5%`~,s5,4aBB]{@JgU2 &(Ae9鵧Lwv&MI,ЗA n Ө.⁩tog'CJZ`U.bb `#qL?_L0tǠ┯0Z,^0sKEXsO&#L73 ISֱT0ҺPmD e#8ǀ3V$ IPPp5Q<3gQ M"$5NŝJ G>p8`$>G` Rǂi \ bGO'"Nk{uT. hXS擲^f\ּ%'Tk׎5MS>->4K@9J\Dwv:Nv 9y)4l9en#G@[2z$h* @ƒOs`ɔy`JNA [n1Mn|rvA6d0!?1rQP7aKӄv?Nqg2e G g*rh0/ mJmeF @DU*.:&Qrq1Q(SIkr5[;9,(zz׃ܹ09bͤlQĠѰ$v"O8 *ԵT[wmeuL"vTmq7*$QaHH+4 ?8O%= 5 p$&K)S@ Rڂȡ=d LeHy1 09Ry7 *bbŸ_͈wJԖ+Wޙo>"uUla-iMUHuS0wmEBJTN䛁J*EPh9-c{Oɵp4La wEAI[P P?Ql .c|Li*GAٳdxX#iY΀?ŊV+i:^/ŋy}Kagn ]@K/FduW}e7d[4SAj%R 9:vPzA61,B C&'7D'@Y"X&cF =8tOU͜-$!n7NԘr;3-jQh@#{iTQcmă._مtnrR 7GRn>{4/bCSLF<i5^o zNf ,R{`)4j>-Ϙ%([lŰNq>8HV;, :}0xD#qq[ I/@ȿ(Q'}$Qd֣)@C [BBJ7 B@G aС<`: frvui$ea΍edy Ņk^tC[DXn,l;F4X C0X"h8u4]HJVW@ a|XsQi7Fa!^#mILC+t9RnO 27h @ )pdwdx:B&KGc+m7UQ׎# JH{\̒؎']"qX!Wʏ6S4S B+!  }1B,,2ډr'\ 4|#7}˔@F" @~8WQ&.6Pi;ԜvV`D't|V]zTL5D҄Oo }P-H_dz6 x %R9r$N̎YJt4\gzv|1Hf Da`yҾ4baV"|@7 n&,JqCgvB:{uY N0OOVm I>u 618ۑYk2疐|v#"CϔQvWmr6Cr)Om޼L byLAJj.2/m w2~xq6pz mjc}piA ]XI=fPSda1D(A&0V(v9,|H<bn iKd >[2Cv_ZuZlk;3ՑMZ(A%xsb}8")h^}.3 $mȼ ZT:UdH(,9q(z/dacaP3fxX!Z!S2FhN 8KR?Qyt&OZp4ʡ"$]fX,%ER%%}Ĺ/RH@ Y:> 6&:Pn/*rGVW*{b$i{<dSGh"FK1j D`8Pi}%C̙5Ͳp.;+d],o*X *!'\3xqֈdSQ)4n)p*)dSd: FN3p֝PlPbOz ӾMjRaY ( ?D^[Fΐ,#rtٙVELvxW gX;\ ɜ.5r> eME#u}jJ[ɍ6GK_c}r^3t/`ʁTxs`ww19}흗'8MW=h܍ՙ͐,sƠ`MlSuh<RR8{?Ւ*$GT=pRv/`T4& -@"ǡ`x(T [!Z/6l8VBY:H DNUYgp2 hORZנt)ҵe&T֘gb*D鴜TpZ>`],/sP28u-6^22Әm1_uR@|5.xr/x<^:Ͱ^3tJ3[m=aۢJJ +RJc.K-qJ#Զv.ґv˩|}GzsMsq)Hp(a3)0=xZ*Ki-8q*=2v4;D$UȖ'i RP}Jcs\$wSݻi/AO#RdGE!4 ݰ-Sn6@':k`a3`b ~}X*./*`>r)^78)IdX lR[+=|G.n+Q8i TZDFTG2}F5r9 Nَ*}Da-"C:QBRoF)02|j;)˻;~vu/r\`u(rc . fx,SP*ZHܖ:l,梹S*+)OO>T 9HT >\#7tM+Զ'0aڛ)"Ln(HRZf)P2")s!ANLzUxU:{X<E㕵%r%CY K/zaW EbABn e3r)\=۳7QFK,$ȥ5e n"B7-Rί.J(hbKg%&2)E{za#PIR‹^1 !TzCS0y@mɓy_//Z`/V,kkY8WdS3@%coBTMhIVjdU:qfK=шNÈ@Tt=ď4%)̹uCQ@A&в(^aWaΛ/"X"NJPNE"<"I W߹gOM5x{R*mq"Qvژ& Knx=0ۆsaB!(3{ZFPnw|Z YdRi2ЖXQv(Oѥ0Zիko:GLr3j%`.<p[vSn%ҕiAgSOĹ=f+RITJ8GN90R9"JZe[!ml{J{s\+x(Jyx2vtً5 ȃ6M.Vd ]٧TOoΨmApV /WKEKB(OES+zsJsY! { >X+|> ;d5"gMp>6~-[ɖ*<ͣJHd)gNhxUnR=-3t5zm9\ E6ֻM~hhמqGΡG qٱ#͂9AS8̯q)\2*^'Q;_%5&,?Բ\ aA}=MnkMv T;6B6k_1Mn[dg7SrS|RGQa;ۂi@O7\?CAPڊ@\gm_P843,vz|D\wt@mUyRBNE}d#YN4Wv4:a{&Y֧4$Uv;RCǹYӦ[EP@!=hN波p5DEZe8!X\Ա`%XGmk6k/'VI*7@ڇoRg-f{9-E9L6KTXK.~-PÇRmbiҘ(邡QS6Q󘎵 PXn s)S}r9(3Aj ?(}WIM:rgi( z.zq[[ -mB#NT0I= Aa8DRQ,G|+&쾭|>f*S:yJ(O17}fʝK `s:n݆^e`1iΆ }?* s˂`Mwb t8lZ[BEXeOQȹ>3I$(͚As`f[r()$NBK!P8>O?J,w<:D7e$?˻T/z{2֠*ux|_' x*JKXg_wάdMf$iybM֩K&&ӓ/ TbiZ=Ml' 0ƱP#eO.:7{7Ǡκ5S ok'< ۭ!|qBGX8_b=Hy=pblT%1Pcr}A*ϣp~xfR!!%Ҕɡ.;q^W8q%xIϼ~fջn O_5IyNss{Bg)Gx e ?Q_cQH-2qNJ,@[=- bJj#@B:^^{ Xgw4G26T=밳=VQL6 s!t։#_1T#ٲ 7yDVqs٦*zfLVt*-8Jr.ԒzXb^3q q'=ᑅS/Vn}9 Jxĩ$Ew eOEvoE6S'|LʿeLSl"*=LϜ>eT >sutNSdmmY,䌶1^-hcs>Np&O.8Dm"21YT2)zP߆!mc gb< ņR\^&@^?ӨdYE ~i>-.5R(Rx0IN%pI]1?"RHbSmRbbf>RTVZvnK2 l*yhB1%)Hejǎ9ׁzfU QVˬQ^*={@< } $xSsną#R0Kq?3Nū^IU\ %Bp CZ.mxTBsoevVVQz3ߖ -}H@1&) %W~>e1n-bV:PIky ]J-Y?k?mK?{wݏov Ti_;/pE-o>okzƒLҰPZ4J{H QY#qה?# ut )^?$@ZǮGm:m8I xۘ8j_QeI=|z|vZ_%q=}Jw@3O@銺9Dke_fT?] NEKUT8Sl;'Oz6JR鎛}aY7_~xq+9T3Rđr%%˨'*D F_kM6mv9*ziR4'WAhzN'QZ>I-@rO瞋s U @qB7 nyܩK7> gYL5o՘`.+B'!g'*id*`bKp)Q$H`=d#7,Fz:жFWrLcA XnEZMT{j K1>>81+069G!jv>ֲ10HI+i᜖CLj7>*؛<j0 xMC۵W^^<ȮNJ ɫe)ɓ{Ò{:d,>&R=(o.k}8O J4UU &*.,bt gh8sjrU =֭ǃ^(Y5,nRQJ;.PI*U\~5h ;n4G?wfы>}"!%SPPx%s9o1ҳʰԎQ.TouGt$J{Fы>N^0B%SfJ3z6*r)h<=74>%)DZ?<~F.(ÐIGb"%؛SdPT 2Qkץ8+FCͶ%=z)Y<:MN_T%u-R(J%SMj,nMs1Q(m:q,/$R<' X F<>uYsnz<g鴩,mA{Eh]zTAIdgYR!xroK%d"R5,$] %08ۧ7D ==#bxY^XԠ8`?t}$XJ[.(.;}0K뀔*.Pjac..5njҮcNH- ESw],8Z$)+\r`>J:l@;ȍn=6/6R2g:wa耩j ,=n\֮"4 Y `NKR4?SR_5v؜ PXKdgHΏ?Y^}{A6sPfOIs'O^GZ'"aÔYYn_5 g!e. pncHH+ǝd&6MD4S>Q7|9,y_5f)CH_UrI F[ ]d C gi*ji+4%cGBe&)2AKvta, }D.nRK@q)[!{UA_Nں8EͲn,FZŸ˨t:L=@ɚ (ꐵ{]JR"TVT 6 E"(M?]J9P$V"D/&e9(ºDd'4OԬg !v"֤_Afj|ʧm"[℞| (3PH*aTDS)øYGd@fiw<*Һ X8UOH .SU@hˇKѩ2hIn_t\z,Sn,\ʻO)U Ʊ)v3ioV@x|`P˪RsBOnV-ePV]$>R(wUr{0ntd%%o>W+yt~]Mv~_tƉ;3bt O"i9RsMY|Q%@p@W+s8k`yMQG(:i)+sR:#0XYJQM|GߖP`3gb 0/s`G) KRl|0-]&`oN|/En S.f!u$cL>iϖ[ K$_xnVf 17Q_[>&έo|29Ω0G8mm"*ruh,Ȥ/|ag]sw"PaD)[N 濼/Ul$)ytYAJi.778yjdOe rm0>Q|@}|}j䬩dCr=\B<~*+ҥ)n-Q/ <>$dYr)>_ח0;rA9c?brfSu#2 >9\&77<ۖ{xEd!俦/i솞va:77XOUH|meO1+|^a{O t7޺nlj P/KR:_f#rխA.2E6LM_͗F&ʍƗI aa7>u'/{ɒ^r*)%)_Ǘ2e0ۥVM> {^Bg|⿌enݺ7B~֑|HE|5-(\9r(%K U>N:h]ГD|e*P)yȗ{RqR"PgyQÝA=|)Z!s壇 Qk>qx 9R:Eѡ tn>t#Bʽr%rѿ$E/= =rZsi{x=aJ/۫XdGx<}E{E?V2O:/.R)ΰCq/bKbgg?u7(J.o,J>] >> stream xTS]})@P:R*;DTzMH(" HД^HG@zDz^BG: !yά53k֚sg0~ ;MzԹ3gΑS]d`x[!IY!Q+W)iʚXhhhOB@FFFEAAM͡)rUD(N0rD&N!$@B""Bb'ob,r'-HX!N(.ti ih.sprqKH޼%o`hdlbiemsfSw/_!"c^ƽAgdfe()-+jhljnimk_@-.-onm1~D__D$~ >"pRN™UFĻlB:ߩ=!.<}yصc#p|Tu# cfg]H暝My!^6o烨,(. 1򉚑:>WNҽV7N}qP=}Yiy*U,<4&b~:6"Z"seNLp@B82zG\4uJ [#0tvt7`.J i`3 gB  ]llNgDip uNBOCS2*t½vH*@5Wip:oI.B:u^J^yEG=iIrDҩp5<4K,C,3?6$:ɑvEl)$|Ί5j'QaJжgiF{.2ľ3+B*=;pIX ,]L#~nA)# 'UyJnپB-˭MyrݔJʸ6, #š4~XvQa(dZ<㩫TȨwKv&:{*vinZ6у|l OTA#큸+#Ϭ젮j>v^ ]oDT}WH0PrT+86Lچwᙣe03Ixs7&aEI0s:K2g610V/n$CvgT,7y#oHE ] IUwzurZQBM?Ւ|A:Ge\:qg"bsv4Ayp B̝*&GS.xn#l#9-`q=L@RHY&NE~&u5~&i4]Wt`zm h^oKޤ~b4zK*R삞 ""I0EZ>u$|By!{;K<ꖤuB3%<T}emf7uVa瓇}Tb׈r/|C> "ɗEh*V} WOam\CeR\)!+-qJ,"F4«`@)ڻKlm(= =?h+\>R{cmwR hsXa) JPCuWAV=!%Dd#yYԄp_`MYeL^!K1(Yfxu^Q-]aPĽ '\{i\sY1N5 9{ܧS}b2fED~. %{[K1?o"R(KIDO ޅ].  E(\׳;϶\ = w)sU 9{<*kx*L\mD_=ψ}fhѱA{rIYF`;C3;-ŇQ= ?݀zK&V-/@FumyuQשOvA!Z`ئ:V@UYm+<*t |f,% Z[DqRKQB a`tNqCeV(%^w{oɝVޖ&j Vpԏ$.Ӯ )KIO(:\h:LNgoU8kUhY-`׷]mxGE)% ɽTUR7Wec^,Fb*Pɖ\0d(e䮾8M 34Oix6efE=[ټLlg 2Wodʺ32lOsђ\}넂66BPl7FSx`RVG]ҩ@'GSݴ![EҬEꝯ$\)n[2zPG'yGGmjdM&2/N1Ծ{2TeDN9V_[ۧ`˄v5󆡀Y9O$s&!=GW$|í碊[WW1!Q*Mԣ{v?{d-]zAV ijh=x1,6(5ptlMTҀx~;T>gp_īn7 R*ί\/hVctԄW#TK?\ͥ~tD}g O]CeՕL%lݭCa*=pCч/Rsa% Z6pw!k֩h<`kCi{z#nS*S*ß}#6;e0S+InEKK$Cy[zeGEKFjT}@ݴKQ>j6j`RMAruf,Zps6kc1R#\X@}y7-PacRz|+RZJޟCx_Z©_K$}ԭ$聻pF^E"=/$ox!2=R]BJ<#_SFq?e[-Br )06ޑ,\^q7O'v H@V-geaMJ3[?FZE3OxXp7fo#.+NhﴆǨ_-\}JCTZYA{=EΝE.)d_z`7V,@;nχL :wh+UB\Jm58mό~YՂ8H#@쌔y=0{$uBy?8i@m Ÿx|S#>)ToW5od{G[$&rt'u2\wWF J~8A{ȹ5i8<]\[t;o.'EH( TTcD`o o%hoZ>J|E&ΎWv7אPT^ws]{O⍎l:^S?c/6cmO8Że )()`],6Ԓ&kx90ɮ4骫l2X߄`PNfoR8 r5N#xw-_o.ϩk'N )j)IG_TVŔ*D1 D2z;Y&GoX&ImabD)g4(R:cU5=3Ѹ4P +4"y{PڐBhQÞk^ߵ׼O9L';3"f$}r"'$2)'CyK>~h?P hpPJ)ibI@on0ؑbg=m1{DpJ֪%G]yfMU`W';R?}h6ӴOo+1$oC~zO%%*Ȯx-.W81 Bl2 ǔmGL"nu]6S%z-a*C}]l]ZNP#Ł"lYt_muT\DKQ ׊ w\iISAK}}HKjqZqSsH}|Y^$fzrxJwgKMv۩窩ܦ6H26dt'/ DI'x`R:WG)ӵwjaJ2d=m<R6 bAj nJ2h̥{M>"ID8GT ݕLq9c2k7 Hb\c.e_f0^fdt0?xv7.'L`u97T/ g4NwEៅ :v 舋+'GR vAWS֡ /aop )}㚂GEVk)[˽6~6QAzLԚz` T[0 ؜uQfD_Q~vD)Ad\\V._,_Y:WT_79F]'\So)%f=DuqMEbsd2yz嗣vf֭F4> i'} #dl^<ޛ!J(AFci %X}W,1$hRi @ RߤMrcG@kaQSyXT7ˣߐUomXK' #tp  +c;iNJ[ܘ`{ cFo3OY%W^ [ַ@>;\ihK\da3$D4&3NGmrey}rҲUHҭ-l,'dm<7"a߀U1ZM]@Em[mo7Nh [cfhsdxd{f> >Oٗ[lk` q?go |n$7l?|F,jNfMuтn܀ZNc;Qx>{gI!x!U xvYuvu?ceLc*{W4؝c?Ѷ] %(15p(?t3`'BNbr-93#l-@rGy'&cT4+ /QY#xYp[]QXOREG9\m(sa  L[H5t[V>cO=ơЃI~10 "wX/+WFU6\Bsniߞ܈vH20 :di?8ZtF3/p/ +z?l`3hEEԼ F>.@+~>ŪKR߬ys]]UvhOYGK8\~Qpt<0c93>Ԡ^bZz[\oS ٍ\&)f : y=m*IiheԼ>.:X\@Ss GX-Iss/)8)ջr2Y'_lLtV Ѻλ-wQ(hƙ` \%d+ leX’SZ?tMvJÈ^âhZmYٹ^>Q//!e>$*dvD>@Ѓz.jy5LPKGuBnzKh|O8W|z]l3gcW3q?LqwL摶ݎ2 ;>tJ=>HgK7r^ \Uez<{ϑFO-'>spXv)oQ/LDKc(TEϽأɟ]|$\H#d{~+Y_f< p";Aǭ7aߺְ7-?0& n}E_ =%6~V.lUtmyH]#+~І=ݟ:ƥoe96P}uFNɍ"Y2_VOpSw*F? Q H^u(CE5y_c-V1C/߰k]4kHMx~I$a7~mjl oH] endstream endobj 21 0 obj << /Type /XObject /Subtype /Image /Name /Im263 /Filter [/FlateDecode] /Width 669 /Height 784 /BitsPerComponent 8 /ColorSpace /DeviceGray /Decode [0 1] /Length 15850 >> stream x`չޮ;no:U-Vj+u:"l!L"++ !@ EY<#G[͗g NJ|2|D).ɦ>^>> M_n4w7Rl ]3{=H@@3\S0g.>%ذasc8s3t6ׯ78gw|:sŹNs=3RYs?xO|,֮d}*J)s˦9yO)Nau֧P(O疭[mX<;@Gz͚k$ (EHyn۾}Xq\4*jf۷^0/@GsժU$еҀ%#ynܺe}>}' t+WZI\le?׭]ۥܶc˰O{&,_r )OT(PJzΝl]w8>?Ў,[|BB ZC"gM>CCPRJҹSzo*2x-lҰ|$h{- [J6$}rhv|JuSZ!ȨmGLi6eɒ%aaR,W9zz =z I+Zɇtg|Xx%ⷥ˖DeR'G25Znz4/^$Ke}^>esZ4;yzR'vxJyƒo<,ycw[}g9s̝\ @-\,$'{ׅytµU]JK;wrOSEzSSS3!11}h˃&) yowd=@:{ړF[TKsbDSyxRyϵ=Vဠ̞ls.]"25FKݹ0ɻ쑲gԩyh@3)))ĉ5w/G:%-lyT ii4~-ͪmDJ\󤬝XK~OMɓ'SRRSc7͛ӗ|㊯K43fL1sLPʀJUyaߥO]M|.._}ߛ7?@ɽszK>Oy;Α=un$qF#-z$ۧE*c?<.RTgfRgvNNnNnnNC>zwPu 6 pꔩ$O!N)O|h6Ut}IZOnmʒiʒʝrȞ2"kW䠓ilȊ))#͓f>|ގ8^yIYWL2e4|Ruɉ?qui3,,L7Z-w~jDTnwJ}cwꝲD 3YN‚3IQ>z_\\6.@F/җ2yJ:5 i*5Z\\O snDɑQϝ*/LBޝOU\5KHXO;''F g$ĹTb%UMjm;y*ꤔH NT->Dʱ'I{N[6O/?ύZ.ጧW`d)ٷ0`~8nGxN}OqK9j"3'UyZ~(dۅgߨqھ˼.ڷMgg䔝;U;ٱd,L[ʯ$qVVI*J 3'l5vj7=W~<; S վZغl(.c~(*f"SNSM%O3I=wh hWVZd"mu(xzZN<{;UFNN9iiZSSSSUQRyd;>>pڀc+j*,m]66֧XxF3FTOB94͙橮įPTr'yQ%z!*J]6ZIQ<{*(fu_'BS ֦CY)I)˧X׎xr,hկ}w+fJLTTVKSY/e'꼽m?r@SxB؄jI%*}:O-"%02;/QymMܱS>`;\hȌ:1hS˖\V.eqR'\N9~*'٥NOfUPnYHZZR|D܎#>;؆ /t>G?_!*TnA>e˥o`|u uӗ|xaÆ }5Z.9C! .KɽSHݜyyKMӓk]?}q'xG%$&:L9nzvJJC3:}5p6OV}5Օe3"V͙oԁ 'm񾗆N]poQ3Y9cG{'Z4\ɲÄB)Q҄Rĩ TΝiYz D YZ4,OtrpMISƝQ*z52U(yTDLvf]vibZ ÷Pk=[( (?#<+v#ר9CGCW|wmOeĄ/ =}-r{ѓ)sr ^J]wTThsY-/-UR#{CRSwP$w򧒧n'Gs|Ğ_PjDOSSAO5D#zZEqD9;M)>/@J~:+-m52->Y ()8z8zf}Ѿmz>/L>A8t(dkgDTd#GOfɖ dQXV33ϢEeF@*D j.%/w&yG*)*< tǍ/ (IqSXOYLM#,ie˸Ib6Ȝ< qBkTRv3i^c<_h5鴲|A5#G<ˍ_WʬBI?U~0rYNo|oiMc(jrG xG"0~d:bp"}ㄟB5B\G4K\Et"Ncrn:hXI]3㴚7َYqV5e9ۛ)`VoksF-ۗD.^/tY_Y-*.5xUX^t;C С"I?r(@ T]B#Ӕe$NvN3Lx -ppi;Lu)N5:WXdU:*, &ΪfQ mj j=j_}]MU 7["R&PP5] oۃH"yoCjK"eSՓMU6b;8[&/V#t>zDg!)٪&JJy(^U%`&<;S>7o[N&j**}UŅА]{Ma<|G.sy$KKޝR#t6Mw"tR׮rS$E;wâj8.'@Xd;O 5)AInqnBj:}-gj]TS\贲S,~U5Km]KK>?z[o5y[IuR}:cisXFs_IDCJ[l٦wFDDiujYzkd)WԤ9d9AguNU/4_,iTC,]n^Z _FKz<%5 ӐdN rs3Oݹ|Q(L@-ϡC8u@wͳ!xWSO鱻<ՠ<BL.ܼP[<.;Ybl™f877'ψy&Y'NWX\Kj6kTZmDbKS&wK+[nWtHryl]=gʄJy )d=]s4'G4$OXFx\"/egDM[8s͆IO3عԙkw |Q~Ě8hk4̧Yej?UO}*U[̪ad?{UÇ0TS>GEqOyy-uJ*}*sfUQ]5BHqcZ]Ťw3<|訳iSW*++ʸT)MgukiqVuhߕ;fҞԃ{3)ubO]'&qg><):{W4OٝEi]Mrf6)[ʐ="q&;۲q[hR$Gc ThjM1Em_CȔ'8j*tTuv6{W\@eUEIީqK͟1+yR]ٳ )@Ӣʱ;"~fV()y):JnqCenéa6=^ԶXB!3%γ ;e`:BNoRR]kYcO5dw4F Or\_I1nXىlݖ:/S,]O$#_z\5橞/ @6qkjh?b4jRv3r\MRf\IvkRR f&o.]jo4,tylv|]W]Y)>w zFmY526Wa'U~/u@2 Ǯ C8.qtqVLAͧa!YctB5>_ǚo4;˳~a1Vd+ AuZ_ei~fFjҡȈ[/߼zΘ:$I)ɓf+bFz&'@~Oldڭm*I! grq ZzX.= (=f bֹg|5¦&'%'RӞOR$~Ʈ4*řX4nwDCe׊g(f tO;4NyEy}Yް)5i Kx\SXtܼ /L(8fI_Nmfj[?5/_^G|՞tIև/o6Hkg[Y3Ļ&i釈dZFl:DYƯ*% 38K46kC8H(iIxpNƒ(m뢯 *ԭP&csW*޶>.tȯraF]S n5[A6ж%9{ȿV+oofG`ǥui>'RA;NUco\vX`c )9sJ(nT[_ o>. NU4?Ϻ>-g]]ùJ2k-_ʩ8 p%|N:4֌~vwSBJ!YW6L4]ylqOYm)s1#DRum(K_VX7?ky~%FAP%N[-^AKrqG'ˆTV}my[ c`pug+S/8hJvDv>_gupdK;**Jl+zNW/{/8ivF~ll6ufA6?I#t^_sklV J|2q?'em+e()6vo?DvtX`i9@i.YMt;Ssy`u h wZe6',yPjrTU'68pTvLRP]2m۶A."/_n_z$Yn&Qn֭tC7+i;;tPFg@sMs'iy: 8ƝVӿfԬiw eC%qKV-KỸ9>sse2I kA/-/<4U3Cݾ.JT6.U)lB7)L2) bw~9YL}jo^Iwj$ȼ&y"$Kف,m"8{VRZNpt%R .V7%GdZԡyZ]ҏ%W(s;97:M,eljlGu!;)ԸUxo-r.wڭH#LVac P-A0P:Nʒ2rěW2f4p乕vݺ "]tY""ɔy Ǚz#2J:&'|H2sNσAF/;Rv4+L-[ U*vQٸnML2DzgbTwr;6G(6 ejo.b7dGǕB!WIsݹ|>.pssSTDR+jNmWCMىuX{MZ?>T訩f:̔Dz@fCo1 Qf] ̶Ц2@w0Kf}'db&7(ze.9ȳκ3kR64U#; ѴsTE;]XŞi'> Fr~#HWg(pf 3TvY Pua~ Ayˊ-4ZJ$- '_~s\zs5iZ@Ωsf!3-5BG뻎8cFyB9LU~ȧΥ$sY'-`V 3_5St|BΉ/B@3}"6@ǑF#a'&ɍ@ TYFysN*kfkIǛuug!g޲-%BSmՎ GT䘻i^[*fꪑh6R>! lʛw8JsMKSfeY2Tg{*S)t̥e2u u5UU%^oɒfYk94Rm(κܺcJmy|>+\`ݽv].+ss f`"L#JK@ŷ)vy:l5;f~ٹڇX[]^V-7i죪V[1!Ywfޢi~7+`HJ]'+N?A{ip=^r4a ѡǭRÅJde>3-Mg֦;r|_UVr 1ҹ굅uj`V:]zؾg9xSy:18!`m:Ie6˃օͺfĩf⬯ϊYtJ}e,Jwz r2Sj^%nf)ޛAN߹{rGU҉ xNL?x0z[qXkb>x|I?ęoV3f_ )؈G3sC0,OA֩Gc#"w҂Sog DUvx-c.kC^V@~ktX$El63ͣagZ6Mm$N,8m㼩.ҥùC|߽gw&a%Y/ϰ6T72WP *֦"5n3&}/ZrrSNE[i"x^^M}@? '4SYF-DLgirtrtgo8ZذӉ&y 2ƫxP8c'4=ܲi]zNƭ?4w}ǟ~jq6sFRzc }40PR&<[@nm1w 9]`<9L\tYmVgȾΕS z_z{ۯ>w->8)9W4)ځxɄlT\\fS-1%8tYN@qLis&ʟ_ꫯ?{jɶZfBMfZ9٥:Z*m&Բ9{ )'O{t;! TC]TF:՗_xŗ^ӟHy>W]:f9fi RZz5.8v\.)--u=Ǩ  ޵ ͺN3M<~VZVeN^cs@enmK]\SHgeE@KK%9[G~衇G%y>O>Ss58M}1HA,)kbfmsRu&dMM,)qe3yzp&8+N]9y_{PP=ȣ|;^}wP 9Քǫڑ)dy4N7Vy2V2L3r~!?l p޷]ьP}qH5$(!119BS q !9^oI8CeBJc;3?>{Ke0 /P)I#Jj&`o4'58,eC6]+*sS2?>(x@o_ b6:V pRk֦;]PP7drg%\adu> W_u:^Ԧn%#3}jڕ~eߩM`HId of_}n=:キg|?EQ 4cm y+d0,6K}!8+2VMuwI,qR 5*ypO#NʃOQOjMXqZh\v ٞP|`/Fλ}oj]d5Ye]47 QA۹` :+23re{O'x_~}gSJnͻW^z-*#2;V*k؆y[+ssл,cyGO8~L_BmB7]Cxyw)Uɝ)fTҴ]zZ&ꕥubtOqQZԚC%4׈%~n]4q;st;IwySfeqsړq,z'_|ըWIl*{K5|iAGI(4wT \K:K=r{/?ڟ#)o?ǏL7+NXf2: ܫLNJΘ+ֹN$|/R[ľn֧O[wY8e*ˬz,;Uwsn8wL޹/?z?҇b%D޽Xo_ l&:RիG;oח] z8 ' zwsgGXG()"? #젗R5e72Z[[MKNCtKmLsqw,6Ϗ3r}Kۈw/ywym 9G%RuPgou;)G+.6˗*Lwkn G_Sw¹IʥFƛ/_mXκ.?D\Xv7|Z}ɺD[{I9ߕ:El٣ǝwz~~5n*N,$mc@9vkoW~O+̛uHMJå!keX'Ξ*VxOK:qoo˾s)/AGN5aSUz~ũ:@junp%?֏1 :I*a[^~w/~=:7W\:bk+.rZ__x 8__z@ע/z@j|J A endstream endobj 22 0 obj << /Type /XObject /Subtype /Image /Filter [/FlateDecode /DCTDecode] /Width 669 /Height 784 /BitsPerComponent 8 /ColorSpace 16 0 R /SMask 21 0 R /Length 6899 /DecodeParms [null << /Quality 60 >>] >> stream xyTSp !:4((`T %% PLUQ `5  XI"D"3zﭷ{kqڜ_ۿ>Bx 4Tqj8 5ByM$kb['b+j?ZdLz:zK__:*hmq4r>D @#H rB|(F6 .h#PH4`j"XG(`tMITe=fv~$9Te,;3Uܬx9 DKR;{G'4O/o:{UqSfwKTtLq3;t8HQ1_(*K+*=w^zbuM7oݖ)?aG/{^ 1X/$~Kt^(%% #(aLIʺT&6$Bod=uw2,3rڔfb))_zu H< P[*gAC 2>Iʙ<6L9(CL`  i!:Ф4k sĤ"H6M z M 0CC|<I'A7b!`  pLE<B #| ŽK$QTi 'J7T,d ͗"R N"`#!hn1͜te"<\{EW2U.'D=L' 嶯^ ? 6^P #xhmVzSa-"x_fb~ ]8[wڻ"}6zQu29ȭ\'9Zc3/#Ͽڋ8g7yymV8(|)e#sLRʕ_*-POabr4UJ,PZ\X1|o;WYq\QGu۶rٵƢ恏G}}~C.@ǟ_Uc v=(ڴmI [Y&fYY枽[lzuUNn5x+bU< RA>|g`ʜnOvORjNa_ݜnLMv+I)WWqM?AH)1+L4oU# k|bUFylݤaɆ܆#soo-nYn )]LԢcV֞xCV=j4 ؿjKChcqeP牰 ر|Ξ[) vo|^B<~єudI]98ϧq%+w/ma-`jS]G?GVԏR klLv %C4,'o= ?'-oo^8-վg觚;;DZ.4?~.h:{1A3%/d0?^G(WvޠTw.m !JfsP̢?\^ Oi09`\4˞f U,-~> VMs@D/2 9hc< WE \A?Rvbg(l$*ܴڹdD1Kī\1̰EG22<4_; t/\N|r_2Veh2t-gz_Rޮ?f:b ;tGW.ԞMAӳ<.pv:ej>1bFfr{IQ s3AC ikZ+YЂrkIC*,3& /XaF^l'Qs/4k!@GK]8\kPA[v|P1Zf B\>g0鼹L){ P[:ч8OHXbok.GA'ДR{kv۵<> 5R ?1ƾ~6EPJG) 17N@cω]*Nl " 裐 fk%[{T#,P9"m`m~B<ȓyI l/3T>S )\4DORʮ๗17.`T ] ?]vchI@@fh(93Sp FT/j{/L0?k<=oI~@VH|P`+ɮFQ* Rvjf➻МxNn9*OE |d_y5YhzIoDOtG{zkMghk'm%ďm 'Km=g?96sJPLFE4 ҦAuc}G5C ԫ?Zb({$GxVA\7 kS Aœkͽ.}_*CR,xWeu9e105V~X9$)0k%2p`Ρ@(0ivGa|m-AKGLFO7* yATx IÏ9sJ"F&ș7O799*s1։qe"e< VZ) h4/@5L X>@nQtRU|<LnhT&Js0HXL 1B(&`EdN/K/0N j7ͭN&D0%QhVQP>dw!/|Q2 N]0*Lt!4]I1tze >8oPVP>:\B A[ rs^WEi2w4ŗ)M9&_@.0(ci`@?ibA :R_f*:lih# FhA yRLl)$;ʳUߓٶkN0zAo)ZÃ>Rf2E&^vOMW"1>ґ%}5s41x'47Jg$)QmˠLvo6G'˷ {Lޕ$MǓ{Vt+ubܴ;R .1>4,GYrVT>Px$\A"<1PwʛaO(6OGX-d|t| JJ[:e z0[;0sN$YfݱV $ /<ҽsӉc꣧2pV-j G+2zOfWJ@ILAUgk %!/8H?T¢dbׁ!1 8o.<9)Z|ԺԉLk)WnĈxS`թ9KLssߦogj؊!Ę0+8& %/֥cz̕b X5~xUteŞJM{ޔ|M ĴMqUPO~=BW<Ȱ (M']XlFEdu+wFb*>6٧:Y9>t?˫(`9n26Κj@84M{**.}eGo|TŘ hY&!sč B߽80Ž#nuei,J3[_O'Q ǟz|U7TEЫ^8Z9|SII6rZdf@-!ڣUN`'=uګ==rGyѥ-{ܪTۻr936׼~jyNμ%1!eRsͿsY"{̀rxIxeiAccƝN~Snkp.Wڭw-\%vg >y_1ˠ 5,b Jӯ M2|~J/ֳ64ONϳL_>Ur\]Utu}/ڗ#oǭYWX$aTF#knkwxާ1ZVE3'`]oɗBeQnfY:ˍ}E9p|X!5&%MKvctvaG 9Nce<',>e,wXD}2}%SOL9PVlb7FZtc~a髕 kɥ}cw7;{]>T1q"pã|p*ў&#{„{ m \uuZpk{B1[|o^H:D:SѺ߁0BWn}\CӃW:N6B3(K1,މڇegQǰ ,[TӰ8My9>ˊ-@p)s:V=u˧L黙f2{Ty'xiu:%'Uݨt3xp?<~Dz2XK%~M'(x>+ϭ@7{å^*V<[o7UF;hK9bH32;HbpGD?W'g?dM rM}WhjryTpȧ4SY{uIv}Yo"UCOq>}!r3;At_URbۛvRXV¢BBQ'8z,Y4?x1WL&)tm++. SFkQ4~?sMU4U}L):T>oZl6EuI{(t;H$Ej ?$]%u.Ь%ZܜꗠO!&`L]?tŧ{w#؎#o` Z/w30303?_t endstream endobj 25 0 obj << /Filter [/FlateDecode] /Type /XObject /Subtype /Form /Resources << /ProcSet [/PDF /ImageC] /ColorSpace << /DefaultRGB 16 0 R /CS16 16 0 R >> >> /FormType 1 /Group << /Type /Group /S /Transparency /CS /DeviceRGB >> /BBox [-2.8307 497.943 688.983 916.188] /Matrix [1 0 0 1 0 0] /Length 782 >> stream xڍ{,apf5kc;=&s\䒎uBn'$I\\1#BDrKϾ{{~/Fg!_;p:bj!6Ocp$R#.Al.wE *ED~p~ϋǢcC|oq0^#E`udK{_&Q/>$$UgB0Fb"bX!9a}nlmmonnol|[^^^ZZZ\e~~nnnvvvfɉcccFFF hoookkkmmmiiyu]]]mmꪪ/JKK=+,,(({<YYdfeeG ==!HKKK))) ))>HLL8qbcbbbDDEGuDFF@xxMv^!!!@ppUt?{D"EpwwwP(]\8:::{{{;`kkkcs@ 8K++ `nn~04470 IshkkA\@ 8d04ՏcjjGr(++JJJ(((222RRRT9+[ G硹 endstream endobj 24 0 obj << /Type /Mask /S /Luminosity /G 25 0 R >> endobj 23 0 obj << /Type /ExtGState /SMask 24 0 R /AIS false /ca 1 /CA 1 /BM /Normal >> endobj 26 0 obj << /Type /ExtGState /SMask /None /AIS false /ca 1 /CA 1 /BM /Normal >> endobj 28 0 obj << /Type /XObject /Subtype /Image /Name /Im269 /Filter [/FlateDecode] /Width 675 /Height 342 /BitsPerComponent 8 /ColorSpace /DeviceGray /Decode [0 1] /Length 25438 >> stream xs[v7Fh@s90 &/{2JZ,%۴UUvʮ{ҽk4&,=H ̼oNgNy%GQE/$S%)))YIJJJj J2}IIMMSJ-#===='|~B#{ !455%urЄB4 DS=D@Nl8Bf>cmDQ'BSSMhfF{,N#qC1IO҄q M uhCԉe?P_OZ{y2i$@Q'݄>JЪ%'@ ǀ8QB,o5CfѣvDBP>E'F"ifh' rOIt3DU4#cN2^gM( od%J"BN*wh!HFQZMK% z$ed9DD3!ԃU"$W}%/m"DP,7t:HByM~$*JE-  },-8Jw&]I'J&ޣDuA .A4;='Bя ^G4ɫDD1⽌Z|&MJ$i'= ' (v6y'~ODPĽˈhzBC ;J:4XN b$U+tpB3'F"ʯXqw}.h*Q<; B*Ѥd(af?t'Ք|nCԙ#̼Vh"kQ!0N >W괨#4*2@Bm>uq1<麳'É:!фhF&5u%Χك4O*:QsriG&| F{zD5= 3/Wwe.ф;{ MJ2}R$DR&_uh=!ԋhrRD"|&Q}#!} :7~hJd| RCwbiMMc仄fH4o*‹ xG}?954B&SF+锨UP>E"#"πu֛ DY:8VJ1RYB^}Ȅ]YTPlN6y;OuD}  xQk$4tכGJ (0lsf_4Q4%?P4hkPⳤ=/Ghc'EФ;# 8L#%%h壘Gz^O49:T",Kr=PV%J{&DN㌾P>b>*cJV:4';dANҠ@h  >t_8{^>1OL $nx@Qy#{ {߼' %)H\# !24EФSIV= Qi25<(hY{BcH:PJ(34i+/i&VLgy|ޜ}Č/X>4iIx˧ڻF<3X0%@hY泲=~ >}FyT4ӽF23T(Me'ZU#-{tZB է˼cD*vh)xҠ Uj<DVF+OMw@xA <ݲLi&AO> =$B?wjP΁Ii@^Jg)YVNt" %=?QJLaBMi[ L*`/TkP@WUU܃qDQV[dnt.gɢ;36^[x"'hZ:!T.Fj$[^G+/xl ;]DB% xuϺz Igj9HJ5Z@CVW(j7TˌT64@M6fIn>N3JiCwٚ$-c^ Z᳡!`yGDKH%ʳ PLrtKu -$(:Lhೱ=C~DuSER"d[RӴLPkzg=O/v%͡B*ɤ tqjwS7hP$:[[ZZ|X:tQx;:|::Ԑ3׻=fnΈ 3:ӄIEzb5(JY&ߛώND0`D4uw5*rQ% |*<P3 gMD jw1KhVmbL@NLeb@Ѽ+:{Ⳬ=>v^:4QoMV MK9ѝmՓ,B*1 e JRvB?N(ܙO]ψ#b-+aTїm,b<9 ڠ *|ngOOOo{G_ocw9hmBiZ<1sc%H:ýp=Ƹ# }ǝ^$p)Td8_ʝl"BIVU U;WӡbEܜKu~lϧNcKM]BS $ S90808dzѨa/{3r;xɛf۲9P wT\(OQ2: Mb`^(9dphhx=ɸ .BBNkJ؇Ѻd: =w<4^hx*sb 9?###QwBt8N#%b2>rpG"4ӚL=fizs"gLxsttlt=8O79WĿY̫tψ IhkP=I^(u Bd |*@ϱ 0D=P_bD{]YՔb7BϋЇn ˝4ӉyЖVʃb30 T96>11999f\ӛwy2o5wiVDza=#T7-y[PLc"TIBu-Rϩ82!Q/-M%*,Du)\@ʖ 8˦za1RLG>aQ+վM{txʄʎJ칫Nlki1zST,[ښdٱ\!>chZn>(AI/t)OsO5Mu~>,Cݑf&}XgP/wc!RePQ(I#)' t{';3/9DM쵏rS?N<5קݹ 9Jcn&Y\ PuB3Pʂ*6~skk{TrO6th- jgERt.d~"ϒ*]H͸0 iLp-uvܲf<)P()PAS"i 䙦;]*|JS۸N:L@(Wpe$BD'<:4暴9j b(K%IP4j@iqHsi{gwԝ*ӍX>%H7%XN/ԶLA|v&DV5(54Љi@X{;\@%{Ɓ|BuDoCVֻ;zn19@Dn(A~iv ?sS..RҠ{KU{}񋕷HݔK@h>!\IBhH2#s&U&$e0J$4#H)ngGNDv nD4qSN) UWr ҲN(OuN#-6~wo"YpIFމvOF5y#ꍡ:*m˲\v7T`"Z[!jI46@ջI =-_=.)9ZSnш\(b7(P;&9W]0~ݟC- |d(x͝sW<YHc豷w4[k9 (ts5Z'I;lqc 1s9 %yORj&ɶ,}׋Wxj/nP xDxQ??`LU_.Td`⡤L(t``j N 8J:8:-Ɣ<:wM۞ݓaB=~{ѤKZ[=?'&j C r[I.nP!~pL01-Ssܱ &¤zXOJn<{Ա&'>ޅg)D7rc}^ӌgo &ƷSfQ\= (yQM u;&%QHhb&{N -=hqQh@BdZ}*0uO;&PFC }'@2qϭ=nՉB녲"hI;P#q,1IMT$=@W_O=#b)P^Th+GHvЖa2C |֌G~hrDNM8< R4;eYS#yBDyi~'' Z6 DgS[@"u<MIN@4}&'yu_M82RB{tER=ӡ)Q/7&eMr.CsY> |+`"M&OaRo__ԃu$T:ETAe4MAJ{,C }zSvfIז|hP}"R@Uҡ4QBR]s\/`\I{ ˆ~PDhK(EP9$eKж68ǣǃvԯI'>,}Zg5iVi:[4PDDŽOJM>5!Md)PA.(e]u\jiC*[l)4krZj@K-*Rv/0eј?N{(^YgѡYV2vCi Y$/t@Iس"k8x$)@^<*/ք!$)c/.nu/&Ή⾆$+Jzk鲿&4ObI"a[0~^fc*'Tig;Mb6D)gj:DcB% "lIŖP{^MdrZ]M2ėP *T'Pʹ*m77aڥMҒ|Ζ0-J7-W! :4Mxm#(l:3LF{AT+BBGP,w.aGQlonUi%t68Dc d !L6f&' ,y^P;L6Ӯ&=>]%B'O2\j/\6h+rC-$w##$ ,zC -շjh@q:F Bh8m8n&@@jvՈ]PR_ }C}`MNΨI$tddڇa](_i)`:F܉PJczZW(dDr@lR]nӁPVb4ۄM3I]>wHulλ&wexK =bfU꜔`*2fz֢3^+Z0[$iQOΦ;ϴ4o9>jKj2rӈbK+ʁNu)p2قhTJ?q zMIph وZ]b&d.|ɢ&k18/^|m!\(yŤ3?yXBhIV \i(@-c@NלlJ4֡Qe2=f E狉7׺P Yt(-¡o+BH7e%dD+OxA#ʧf2Ј6h 2mUƱ kT"zI/`"x2#HbS;_L$B4hQLSx8_Nfln].c'C(_SF^zFn  -DIpa,Q*N"t#W{׈ѧi^%;Q/TsZBNw y gZ1\)#}%@E1UFפOXNWe].ֵA4-*h:ӽnh4WnȠ|t;w ~$#/tC |X35x+J4jJ+=n4MAD33 ih QOmjJ`A:`!2\IjR^(N~<]-["v1I,SNFP7U7v1 i9hffED龇Ug  slqGmmc9IhZiMjX~'>{hq4̃(TQpqvԓ yha;C&yIB1ӄsם 䟝YN2'C&`4 ?8s0f4Rx{WƳN/:6o䕌8Iq WPgӛ'eq;+LގDebqh5iRB,;= 41=';e-gdf OhG@@HQSdB>7Df)` -26]TV֟Z*ZؐE4 if1|"x & I?tB@Х l=sB NDŽ$f!WJb)aE?%B.uhPC'tWn(-z'faSNJi kNtlT|e븋Bs Q6fHH$=WtrvŮ&!Yp\$'Q=>wТ"dAupUHmIr\+WJ }e繬i1nb0vDjܗe;3R՞hQҩё4-t2VWsch#lee] Ywbϝ=SN(njI8vZc?PpY\CSȣL8g0%RLԀ]R\/\ؠ[iG!*mB)L.dr8FojFK4i5Jegcg )cevt\u#Cl*'; {q,P!>ZM8&:9GxUB8lx͓ˉlI%wT+s]$$1,PZ„r@~"5]K|Vo;R4!ߌ^(-™3lw(Y^\P (LB1***sM/,/ PExFhP,_ ^ca|&ѢI#[G9 NT6MXʳ';M*y':@cLRKa&696\äupYe!n).VS*Pp~&< ݥЋр@/ ?1thP ^iFp{|v0bI(qS}Xv@%%Fy4@(VPGCҥ)oTC|*$ N_g-ZYY@)we8VH8^2AS.*X6)dϖ] >`0^(Nx2'ab5^s2uɶ9z QУPv pk]QԅEEh^uGSo πmL(I~qir|cXRW=9 Q' Vc{xPM?VV4BOv NHBEm6ER@_]E JQS@jTC(͇9 ѝf}VS2gy"I[ptsdtbj 1ҍYi:;_^SI=Jnd4(QʳH!<5ŤZ  a F Rg%f]rD(FhP 4*ГS*xR̮U(dwu+r\IJy-䍖(3|I%۵MqA&f yM|"{pȆt-6(:ɈZ?Eg"M$+ں-1$)BQ LT챢qXZyt[LIK+,+uj V[24 fxuגbTStѢdF GJn)qlFs!F J|\,0i;TRdPpc :ޞpT`6k1ZuĮA3E*Ѣ r8=T\N/gex~; N~Lw*'to P1\)ē'>h mlsb8Ղ࠾MU*zRղrDȺ:+Hn&4^`!LB'tcFF+ l@mFMQ@fKkԤ P7xh47uADO }Iz4@ ":?/wg3 Y J E&(JB'n ? ͕| M#5)l hCa4f%F),b!}!(aZ@8MNCby.xѠɤ@bBS ʐh4ϣMG4#D<]I.hjinj`] jQ:#Dh93ǙtIN3qOY>LqD6(QZ[,e67IZR|ҚҢ 0t$[_1&4%qB3$.5Æ;Xq¤j B-6UDYvxX䂤XF-C-r\_.eSvN;x4Ld S&t{op7:FPv#xRQE䔫m iИ6Ѣ E}QV@)0)cf6\FN('B, 6;5\L X !jM 4`ɺҮJ"7ӒY*b5#(|*%s6t.eY@֝/B!tE H£ 0<]\Uh17qQ"P&h8ΎN\Eh f9鄽rr1R*RZ>i-xPVO*t`;wZ2R{4$WiI*hQP5Zw⮼27u2yJҠݡ^Lch$4,tjƭמ.*VQ8;;?l)p&>%5m9{_QCeGn$Jp2qj5ԇπeXJ ;KJ)Jz$%*;REwbt0RqKA8D?z8j;p\mZP@U-JlwWup,m"bɸI{¯j)JuO8WF(v7$,۔g o1#@.ʓ/kVJ>(Nl"@䁊 b'5ܑ+>(z'Z躙b^2 mGDXR73Uube#^wjZJ}vc2)N% E@{Y kl9Q BO$nK}' yC_[ͫ[5geP'鵉S6 :7G;YJN#[?^Cg75ؗ®.RmdLKVo2kA͖^Ce)jY^\eȄNי6qρd%I'\6"p/(RhijB]&Tı^ ݡiNPS?;Pфwg^L_DrԌv nwl@e{{B D66ꀞq)BjyH+!LIp +DL'fC3`udkhP#i Ͽ 쀢sBKC^b6o4jќiӋmC>UL*F4ڊ(MV2cP! uUkjJm +B{$u lf+G<v4Nj <=m_X`@_dl.!|,Vc~;q-;J.uaVD[iL%Fxzֵ߶bk\2Ow(4]s\S +nz'1|r@ *OsƇVUh'Sa'^ 'Ѻao1Q)nfIֽ -nP+{%G;wfgJm;4ѬQ`~Uv7q'==0;R%DQl`a Đ]\Badj8O 3KsC-?2/:ѠM<'\)'i+NvK|`h`OڃvE{J7?a||V7,puo :@x!@,:%gMSgPXe (^)PK /R>248Я NEd\Xdj!K)) ܮzrg,fOX(IK03DN/8W|I{"T{A!Q?5%a >e)p TV4V$y-c#C`)Xіf|y2غ'hfzS:ݙlЗu^[K'+z: x@Exrrbll%@%D׊{ pv$<-:u2ʩh*<'9_X\yAJ_ϺzTIްI;Q?iK wd\HIBixn( JhFCh軩#h&T ~38hhI'ΐ9/r] ¦\\SQQEuuhi1m}Po.L gnԺYrpœiQ6݈hg! DsNô=@2(NS9Jb&T{{sm#aҁm3O5wR=8n"( d'Q y|Q껺:aR#9T+<8dg)\@7UN` ǐxM.gsw]?.ɥDBsq{B>s@(^D)3 }=GIȲP(l;J݉ ŧeFl% 2Lw ޺θBÊeE%!Z¼hP(GL쏐Iǐ'wTyE<t]|нJ#2 _/KDd(/4s]XbtkRR*QB¥p 1sq9sBԡd)xq'8Ciooos+55zU絣VgO(w>>%xle%B'!V< YQ%'Q&&շ R &ѴcJ 4<9' ã*'(ЃZT<$o:@y pcSIj[^]1B L"TFWi;Fs.(8%nDw>ĽM)õpMYw_[kz)f}ON8SHq*YezWH*V=fƀPyR֩wprG3脢;D }o *:ypxx4q)?ja.*;M0A Hw*3\]QZT)Q(`v[(&!`#% 'M*ifc">9i֗yyw$l qHu"+m+CWT<@y?jDL= I8fA}wO &YH[eOwS2mFbg@k'77*F(m?(92|9#&i('DݩTӳ^t6Gy G@ex?-.qAZ{67!BW>:tbQ\R+PҜEN6:A{y|rv~ wb -eE }@?wŠq- ˈ.-qmsxxl^/Nc.rESbs?AwTɩҟgSʒf4w{WUt9םo7]<%qx~3Kև׉餥EXWSk{bs=OО|*:/_썴4ͺf}ʘR|>{Npuo)T KTDŽ$V?Qz#n2A^T'ŸyϋǗhճmюE›Pg ٝ@o).D++>KyO#w_[!$-Oyncsg<ff lJ0Td+ v୻,͕9>!B9W{iA#Y9paSIi%>7LqҟG<>+>Mvv}ӭu(P`GGw7Ϋ`& ቄb,A!PhN][n-H"3S x>}3Q3Iiκ 04+"FF{*])hdX2dR :n?6Pj`q__g>1x=/./Au ! |Oߕ|z}s:ץYs]02 ʴxNЇ` ZU%Q(,#(Qss |O*kBesw(yJ^)>vʖzVt} 9/lm; MЗ@$)Mܖq3}^<y}}}󋅐\V6zG^;O~ L^( ]E0'ؤ;w.Y݊ߟyW|>`ӛd: PMI`p;5* ]CB]S`"gp'uBX PП/_~؛DKҞ8t'%29v& \!Iv!)}ʅB~U$tiuFڏXSez]y ruCXxˣm"@Kچ&芢쁢e;65Jw!I~!ƒ} vD݃ =b`O?<~7OWy0FxO.vY8J w(zkuJ+'@H(֕ =fRWr'`uׯ_Oh7O#sydqv@Ѣ23&dwHJͫx~m<=98K&j1=뵁.!a~,nLF}5LJ\Z^M>%tmE('qcLEثP$tmm}T$Mb(z'hcǓ]֠ób@ OR MZe8Qn<@I 'P*z($" 2^=] .9Gkh(SKv;\wK?Dy߳GrE>7ϵTrǤ<~K hW:iXUG$=Yҟ taiye\AJqpCR{{;,/3(Fqc.?QD >^Q I"txSJyyt;ˣ E %!kLԺF9Xn =FU/yQtiEH!\H-QPE /'U*LwUJPȾtiBaA֑ \}0%eAOA}N苓 _.ve,w*ZI4@Wx|s@WCxoSDAȽ";tZ|DźiWq?=!Jb7m_! nJf26}HzQI%)ޯ9/_=l|dv#N(|s&@.aKVn6Qw1kϱxD|IZÛCb)}PK{B[ap% k#7k}I8_lBfcW(-2?gB5nVv&gcëgü&%GTE"aиnlsܚ@+:ELTMrKD䷮A%P骧uo2Ȩ)u.AMLow[Rl9S]0Mjv4Q&t*X烗O2fWmuޔlD.zԟF5毯owIT||u?. :6V@r$fQNR]Or۷0t :Keoo5䅒aYO0=?m$ ߭7J失q.Ovd?+9KSZ n'n^;cy2/Y5bAGk]{2wo:#B sݾJ@K\N.쌶{#AB$'E"JFZ2]xD$b`'R jQ=_uppd >x;n,Thŧ^e+ӛW_ /awoOtzOEf1779!᮪Ph)j[{gԒ(sɀ&2zm5vX|ZrL|Sn4e?ؒV1ti?@#׈) 5)pJ)p*Hh(P* uS $AΊ,?rԚ3"|\ѽg~(Ud8Տ߼z %a32?O|ʧh8upcqZ;HrV M>9rw“U/J_:|P{;94 R~{(dl| uw'E$8__|ƈ"S@WuvHOgW`D :Qܑ埽:h7f?S^ s0RsM'wmrL8((Ë_|J~aa*~|ʷCzl\ 'x@g]kwUʻd #8>믿˯_x0\B'f{+g'Ǘ{k2tU>څ2tKBo ЯP~. \2Ex*4,ge i9\g&Ctlߠ`ړLI^,mt#c#r>xꛡL=oǝðrjk ([݉um=%ORosE}:W:gg>[fWQ닕.Ksچ'v@`_{U;~jjmx?:[&S{_ˮ4xXq}Z}kK3]cwHJ46o;%ߪw4KES~O7GxB-DG tחe'Ģ }J>oJ5)'7KA#]֌8-Os PwO'G9GgPE^7JFED_<۝U@26:Aw78CeytIjYd85gX?={ϯO K;lߥi Uxf̒QmK;hRП?ՇϿN0'c=5CN )nօ3傞P|D~dBh1v߲5u$0Ͼ@N=|ew? ?~㵱0>eVb)VQN>T2*:$?)1xxoGLSE$g۝|dն-jS|O/g:D:RoNFJ;Ů JyvԔd';%%ϴ]3#|y~#-e:w/ϰf!us/XWv'a:~OoY~o`n03`V}l*/LpIy'aU|aOo~|3[xO۷߀q4t޶l'.#QzǬF.}$ _~zgz 6QE@AF5'M>?MgD_~/.7'$$Pҝx 'tO3L=$B }+:xs:/!QDgWc(ۭXrGJ`xx㈅3Foui"lΆڂL-ŝcۇG4U|̈|ݏP?ښ4[p;*SO'dWmYF^xil@]9oՔg|N\98Ԏtr?pfل]m DA[\]^s%'IJ YH\ꇷQ`$p? d]6?S7h7EG'/\4Rt~s{2IјCZ: ]ɟ@|;l o!^M J2C]u%n笓?tՆNN@{BB"w/6gF>1ξ iiba['_~ˈ*y5;:4]p*r}\HO%ËG-7~F~yaK"exh=XWt򧔬ٜ|||v~S~}25:dxdx8R"u0lj,/IKvt'c?zyo~o~7w&FQFRŪ>w4eІ?,mX:: e_*"w?}lc~r| eԈ@:R(-Xɿf7 .=|g/^_NNN(Wtd0?99Ne٣O\]]=}xc~fzzjjjr!HGz;kSNQFUӧ~ۿz~4??7;;;eH#*J- da'зrśo?_<\]^Z\XXP3S#ݭMɿT_xٷ7//w67VWgCΠ;ב_W'{[ksPSEmQ59הW./ΏWg£ __KwWG[K=͡$_˶; %eS׿?y~s80;^RKHpOn<`l)Pt򫒔>] >> stream xxwXSEH^CMU U *t7JEl)tPQRH*}w>/keߜs3psThh2CY/ _VRb~CiS21׿@nBDCC@ %JVȘ8D N;6 "%yD R2r ¢ _@ b)) l<@BGJ!Jƀ!t%Qp]i 7m=).^bdSS60426153}@DGQQI)iOc %k_4lwdt>:7[Zonm~?8<u˸qH""=C^An)FWF%܀z S]³y"G`3@ ""D(0(A\(DP B'͡P ' yO@Зa,K㭢}YftyvK%^s>zҾdȋ\$H768dRej-ڐ)ӂ;!s"0(G~sêB @z(hA_&Jj75] ~ȴ[5$PdTIIIKI'ɡ;旾fN,i/F%@ݎ/EuÚ䜉(;jҀH 꿞5J(rկPٜy% oS*M1a[ܝB FQCu9I%[21]yx X+- H$Hu1Bc!e~vGuQ :0qu+ I}nwY@maۣ8,? ]P)m?<[! $l~^* P DY 0 j$ѿR?SVb&"Cam_n1J)j0c7qh[ EkE_< '-k5282ruU¨wK ;R}hƚ_c1xqqםm7)‚ N&L<)G( &`~)ԃe|sZ2DGM\ S!ATEU=T@Vj7^ݦRn<\r>3qCGB<*i&"ByKK%r0bR a\|i=CxdxU55l(N(!-p䝘$߿-NmuxS]]ė{5m ID&z`m׵͡ePh.tnE;$0=FDhqȡS@OkI~XN4RvS3Z'|ˠ*Q$wJ/I9r r'87zA  B{<=2z9ቩ/XQ""mpb! Y0C02`N =i /)SxjI6ۿ :ܹA33D= n'Zt7V&W؄x؈MtGC&[`WآfD^1ײVfU$׾ﲣ}HRemv%0''0!ov)`5(7908R@1ad"2r-FJSe@b*Ӳ%-jæHHJ8a4o B3Nxi%AFIJ->{.[6 %ܩ]<,I KdA;top :\kLJ'%^lXrNښEl6s7i6lxA \K 5\>uutUgF *d"+SAtsVtDN!p'XzM%N0X#T :o&s,qGGYZ*˝w4 t@XQ߱+sI#\90qwRT_r;Z&%u5(-S#8|VZJ`W9(޷r[ bp- î :>=1K H ы b 4{a?ɮԅeNEKiچkG V}{t[+O4jPrE)$,& զ>S1W.0n3%Z]bcd2D+YsJrGŐy=V2/nIP Ӽ[z-Sw נݲs"\!oml= h:1;!=>ޔ}7%f}ؙ>6&giYgx d 45C}+n]KBJǞh;ı+dHq^ çmyvy)R5@ ^$ ?oXXFK[nO!7-sR"zbn'wa-R BlXݏ[j^ǒD޺ExKs6#\Ljwwp'!4rmAZɥ jlٽ}>,xc-ԏ~~xC(JL ٜov~ `*|?ē_i. XɒT.]Í*8R`u+ezu3{/63Eq67+q62^8xiiξ%SvgUɞ;Í4';!E=zwέd3#-K\0Qy87qzчa퉛3R5vO)SUiܗ4nҠMD laAC(%S3p[&'.g9Qv\uFž7{ t 4*q# "w;h]|@LrO?ɔVu ̿޸7 lܫږy8liy= rh\rl gH'I*Xh,íNpt5#*v-UPV<=xOqF̱lKyތ-ȹ:+ΔpIb@|i  +ي#tL 8HVG_l3E渒̸F):yK\(N֢j+<i7Lǽ). x[;R.Qb˅6w]q| eKB Ma#[Y r я6M ǠL~ei;B}u[*s (./[&OG7q [M:\fnq.)bfE%F.;I99 "w |AڽTx/]e|̝isѳ4[_6o|rAXR0~ }5.`V)\"@ډ#T9z¶ mӴos-\]*ޱʠC{yA66HJbY.X[RY :A>#adфf1Lиc_˩PK9g409 ^BQq`7;=-3B?Ǡgz_{:ߟN830(6*|_&J>H!4gܬקx.c=li;Ɵmc5Dw'{n4[۷nXwI`Ww1 ,0(&yeŅEgʾo^{Aw1E1M7TK{ pX"* *vJdE\Dנ*((ۿYo̮Mxp,)&Q}[U,i A~ɦla9=hZB0Sjqѿ!kZ~tn]MމrVe4 O\DQF $IЍ±5}Q ލK)*'U&} kW:,' k}hNJy 8- $TZz$6i}݃ P<Aze ȑs7l.dz< 6ynz4xso ڣxi[bF4+N6nSqhތg*xG&wxNP1=Rb 3@<5TV 8s\%sg1fr(Gm(mX͌[RԀWIP5hKȣ456[w.lY k"BCx$~5bګWmJjJF/$j`:EsN)\`cf$K:qtukNn~ C;s`Ef/.8"6jдQef7`Bh $Q`%V]oZwW("ЮA1sAKԊNDv]_RniU+2ax)[']¬4DyOTf ՛ݹuZ*mGo~ km0.~.iMod>ViN]ٷ(t%Mwn Irm}STHL^\0@"MC@A&&{3k%zyKyqclv胾Xy ݋,QGf 9ɇٕ3QPoޅiځ>;h;rD|HNM.o tH$Mt&E#ڝMJ9+@WqҚ0jlR69X*hxrv|ËMf- 6ZL8t߶䕾@9 Z6Mw8^\{cz dȔ~-m,&3'á%!QTF 9 i""kf- X/𚦷lWSH맾ގ!RC6W(^ /,?rԺ2GPiH;̯|z{46t.)/Kt]SHHglM'h _ai\Or.YD^+6VjYW ;׃CѶ-:kK:qbO&55&" }QZ}]b0;5h0 隅UauLNj8ѯRsG7ݳRR辛d'MF1?1O2._r =9Hܚ·^K¹u]|eX-"-xK"La8ږVl<ƍw/WLXh.l6Fr> HZŠp)Po+*ƞ|cìc޾%ЙS`A:5@S͗eLٱK'Hg,kerbJ[[ .p NM,|봀累UD鱡 \6$4]+DITՙL8V|w`ɫ'i1[ lG8j%5tS3x>>x#ZYPg{YjFr,ޕRpyYQ_@w0a0(L8hԏS`J޳kR MOG'=`VSʦU%/5$jFRâ-9h{562wW1:o9S-*|)rB,ovuǜɋ,?Kp:|6[ΗеñO~:Jޠbu`[u)P+/.W^ܼT7L_]ܯuċ,Z0/O 5RگK PYd.] -+cʇ> 0U";4FiTR"C]fA^n#.cQ\ѤEW;,hrwك G6Le&zU%A=^Y. K=sOp[.Χ spga`eGybrM J+7- {L_`BV~t Af+.y:'SDw =J>=k}sʴ#$|"3lI6kfx i#%F1iwlc ݸxO{{Z[W=^(;>$0}_jJ)@XNp}Bi+)Ju򊐓xcnnru+D轛FOc\/;)bDv9eh$ W()4>dxF}_;Mކt*[4|Gw+*bߐt/6QQ|`mU8s엿?\=bz0RG ;QCCQaː[!L*tmϙ((nQ/lRh:W*k _^ND|T=d%ZplW! T.62u3\xp`q\Fo;lGN^&< ?ĥT> endobj 33 0 obj << /FunctionType 2 /Domain [0 1] /C0 [0.741 0.224 0.243] /C1 [0.929 0.196 0.216] /N 1 >> endobj 31 0 obj << /FunctionType 3 /Domain [0 1] /Functions [32 0 R 33 0 R] /Bounds [0.49] /Encode [1 0 1 0] >> endobj 30 0 obj << /ShadingType 3 /ColorSpace 16 0 R /Function 31 0 R /Coords [0 0 0 0 0 0.72] /Extend [true true] >> endobj 36 0 obj << /FunctionType 2 /Domain [0 1] /C0 [0.659 0.812 0.271] /C1 [0.824 0.886 0.545] /N 1 >> endobj 37 0 obj << /FunctionType 2 /Domain [0 1] /C0 [0.216 0.514 0.271] /C1 [0.659 0.812 0.271] /N 1 >> endobj 35 0 obj << /FunctionType 3 /Domain [0 1] /Functions [36 0 R 37 0 R] /Bounds [0.52] /Encode [1 0 1 0] >> endobj 34 0 obj << /ShadingType 3 /ColorSpace 16 0 R /Function 35 0 R /Coords [0 0 0 0 0 1.29] /Extend [true true] >> endobj 40 0 obj << /FunctionType 2 /Domain [0 1] /C0 [0.961 0.525 0.204] /C1 [0.969 0.698 0.416] /N 1 >> endobj 41 0 obj << /FunctionType 2 /Domain [0 1] /C0 [0.855 0.435 0.231] /C1 [0.961 0.525 0.204] /N 1 >> endobj 39 0 obj << /FunctionType 3 /Domain [0 1] /Functions [40 0 R 41 0 R] /Bounds [0.52] /Encode [1 0 1 0] >> endobj 38 0 obj << /ShadingType 3 /ColorSpace 16 0 R /Function 39 0 R /Coords [0 0 0 0 0 0.89] /Extend [true true] >> endobj 44 0 obj << /FunctionType 2 /Domain [0 1] /C0 [0.188 0.322 0.565] /C1 [0.188 0.443 0.682] /N 1 >> endobj 45 0 obj << /FunctionType 2 /Domain [0 1] /C0 [0.145 0.31 0.337] /C1 [0.188 0.322 0.565] /N 1 >> endobj 43 0 obj << /FunctionType 3 /Domain [0 1] /Functions [44 0 R 45 0 R] /Bounds [0.53] /Encode [1 0 1 0] >> endobj 42 0 obj << /ShadingType 3 /ColorSpace 16 0 R /Function 43 0 R /Coords [0 0 0 0 0 1.29] /Extend [true true] >> endobj 46 0 obj << /ShadingType 3 /ColorSpace 16 0 R /Function 43 0 R /Coords [0 0 0 0 0 0.77] /Extend [true true] >> endobj 11 0 obj << /Filter /FlateDecode /Length 24147 >> stream xͽˮ-r%_4oMv*T` je? 9jq!\\31"o)_oR˿_vKa՟=}F??' w3?~O]g6ON6?c|?/}_o~J_߷YOis|RRo{,ۿ!˿z;o'm~fYl~{5>Wo|?cT۱Y[w>;TO4Qہ,`?4ҭߛSZ0wP~wX]<]L9'7GoD_ aƻ w﷥|HJ<ԗ=9k¼LC?>N;rW[gڼ-ū/w~sڿ /]1`n4\ knī///z[*[0=O4L-m}q_oj c'5[tYE|9,YĜ] O]+R mY'#UNYwNTK;WBtw>@O˃ ʖ^tA/^Yt[,-ʹ|WmVҙ,T-mO skB|BHǓmdI) `^ygϿS2qZ:?ܣB {ah(X6Hc[h; afz=k"Zj+Vzm<A23vD #Z:D_XjdC v դ'i2nŧNsJȬzhntJ?KINƆNn%vc>߿xO'Id=1k!GT`'U ŒpL>(+ظt^:3۽%__xIO3.fk~+ Ǻy _~H`-?nbM 8/'9;~EWڡz#Mg+^3龴ӌnRN+۞'x R^aAhSެafX}^=A'H^JՒ rToD5Z/<3 m(zt ٨C0$ՔZ0wOAu"#3]oM"GOɺ VFy$ALk}Q~MRz"ֽIކ6좽I^P&X+|οsas{M}ɢ-g5F#gұYdvyI;za,4en$s.B^ݗLvke>zzV5SMr ᐎФ.\DҮ'^X'ΫlzeF1o-:˶hY+<2a7e`kICB&iGߠ ]^x%硑OuY`E米3IL7^R;+vRQ݋%!K L NQ,e~=,8.odMRϔz&ЕG+ {G]4e^q h7؂w4%a`QCF_A&ipz~syvB/J=ch[ 3lz?ּ~ڸ_[.` Ⱦ,M?ٖՄzD/Oj +zG}ot+'{z1+,m. Jzb?٫dӸ¼TycFR) Sm~#6 &+?u> ;T`oRN8@l;ؔ*OXڍ=F1Z@Ücϴ=<8_z}gk>8}y~ S.h Xu$2u)k5-V(dwQ{ۊܞ7](\_媿?^;?"0A}iUJ$[Ye/$a\]pFx^ykdczIK8C_=z=șVdR x; 9Sx!Tc4}Mw a1 Ñ*RwT8U"Ԗ!=v&zp-xXWx&'$sLNje&/\/]Ҵ7o`*klИ8p' pP$B=4W'^A' 7$b~{:m8#D;&=dEi̚^.Xi^r84ſabGL'(iI^hW 5!C:2ݠKTI )]#dnW.:@Epݐ0 cp=r뉇G>U/#08<(M XiWBw蝇GUcĦG?ɖa~%IZI.X!1ǒA,}5]3g-y\ivmh,&'3iE N hNrS`6çH>o43Y3d$v0۰rmݗ[q _߮rqe?rud{nT f$'D[MFٴ4GQqw!$aExz6(Z.I,sWzqܻ;~+y{ʃ?M3|ߨsIxI;@T3IQGK։pYә ӾlX0x "l.o0V7."k_&|={|a յW.K~y-U~``jiiYnp7$DHzhz{^?^V sdsh@P35 MI\'^z ~^l={s"C@vR~x:މv/bZ¿ 1!J]Opub'х`bZFp+#"~f2 aaxYؖo.{2m%.ʾMc7]F}՛47ULX[W[Q&08R P8tڴ>fBw 9T11apފBtkO 3I?DĹfY"Ƞo %e#_m䫅62zP/Sge#cF^:.;$]6:dA`62QG)VB{]w !s1dsǐBI߁3]qH㰏")eàA#k°| _>ƬmXӬy .VAǐ[e_1ZMê2A?_1:q[Eӕmm].1a?1v8 _1zz9VcG+>+]1$ey< tDrgڞu:}Yǐ벎':ƞH_z|'3~s+8yHZnx:r:3vɎF;h0sհ(А=.MNJwh!)+x>7bBL{޶{vR%?Ec6b<ƞw?v[AYmV.'ZM.V˔ Th&~KrHc`4}2_!B$McXHuҎȆ)ÄJ~moM46w(lX Aݓ^qB` s2#b !fαlG18ى)e=A~~iN{;N} ȥ ;ttl1^B4Ɋґ^^WҩO't^+>Rl&ZhoZQ"B]cߴ?P[Nt݆Sc\-bU±'2!0zGf^maLb.K&xKTjz> Wh\7?c#!ێq- )3ͦhiaA2V#Dh{"PZϒp~N wRv;(xZF@ſ BCՒ#@8v:pB=s"z!WPE D A%$@9n` RBߏBFF͔ a7;r $ X;g9Mf͌R8beܽ-"Mr.L梳d$,{7ԹXL/EAC@ K/ =N,.pTJ)=n16T=S>s~JS)E3@bi9Q'y"tP8pk 'Wj?iѴzr6dO^ea9t_"GۢKM$H A=k? E Önij{׼AWd.#XSAF|oefzcH=O@(,\J4 5hI{΋z-y]'v/f01h/S 9ST_Z NL 60@U4eMo4?DR;$w#]!Bc2/$ r{՗8ɣZ1r3E%m2 RK9kҿs; ᲚzAZwmK#f$:} C\TL<%O.W[-iJH嬒YѴE2*QO(oH0|!٪'i&;mڔhl/4+ "@s)|砥%&Zrb=AsIg/¾{t}zUrLPJEFk2z@HS]}8Aڀeb%Xp}'SA.bb75P$&mEIFKfB0+A&KΪ e}t4×/{&W[+8?Y"d1a$~pD:YR~˘*~3pbmsQU܀B˜ KAy(={_Sm I6l_[\ep#s|ΨGe҈p >u25c~!(2~a]U>\OK;R}FͧlwnSՖgeErH0S3=-vq,ϨJJvnV =!= Ҡ`ۨ?dN`t:wø,5k4JK2Rt%ӏ+ΜN\BJK*X=`N@#]OO~JXFX>$HJKp kaYЖ.2fn+; !W|준 9d婖^zcCr_މ@ ; 96vk; Ι2Uܡ=ן#qK@qzǵB'q҉Čd풆d1Ha5%zZauUOǔYiz6"в,r:/i2MLɪŔ%m BMzMY fKh%CR'*#iHAI@=㉠mHݏ-yOpCC%SM_)60-v)sEUc[GyKҹE(QSnIDG<CM}j=X8 M*T68/K.Fє)ԻNMI@v_Sb*t nkd ,] @f@S\@FqeA<(A3B\0e'q>dk5Cİ:~a Ñw/+BYkwM'j4O]t^?@v>hv!qż.=SSTbOxX3fM7?P0l 5U(stnkBE: [e K7U8;D耿_}h{W-KOD$h;ВQhv z_p;~- G^&mu9oQ9Hrum}C~$U!KT7L. JJznLr4( [ -vIbZN  h".T/[72h3x 9a15D˶Qei|Ӿ>QXUtyu|QʃT,4..<,mOȱ` iՈXf(=VƳdm:3~I~84ʬ͹h͖l4(j˒çeKA'Fȧ.wdFq%ANtA;IPGit(UHXSV]B<.ۂ\UD tqZ/)J\6MS&١d݅UwYcS8E$0)#M%`JEQV ZnOe`BonGGkqDd`e !?~3x}z,RY۩lqζ̲IfAGz/F{~5N^"|PkoQX)C^"Ӻrj3aW>)"\\VOD3.5ʥlD2EҲ&axE齤}~~#r0Avpx^R4]xbT1w|N77/i 5_AtV~~:|Vm}𩴄Ax?@PBK 9.FZ-t¥pe$nv~"ɖd 3; arSIyDr㦙ʦͬD9"1io+372,3&Uǁseڳ^?G?vK4Nc<調WDh! L,tR3 ;Z8f|b7%ջ~Q}~6];XAҾiCYN&2u-ҳ%S[OTa,[d XesqO"{ :Q]IIzi`Vis7rES2ohz|n8L _@!D i{U WTA{{F\(4Lơ.|5չ`{Ef6Qaݸ(P+RDAwk.̸ s֒Uo$WJD-g#vѢLY?N8T>WOU&a2<(Yi|@A y6r{w-F\.劼̚!!ॼ 3ק(/jjEՌi3:x*'@3kȆjp%FIz˔ 響lq̿AǴ6NɺK1($u'@ag0 ')a/8\h:00< ]dd(#+`ǥp .ތt!aʻ ŖK'z&nlĖ짐k; 8с ŘgB%PŲ]+UtYsjڎ3ِ:j.ГX.ΡB;aQ S;q.P(Q<;iM}:Yhw˃Pʥ£zD?Ci(#ţڦ]TˋP91„Ja9˨hH/ RAC@C=1ِU-wD-EY%|+pc8$mTP -Ǘ:nH %>(r>!GQs0&H9m)tșbI3ܻ8K֪$4Q:E͞G:A% 7,rW  6'90BhiYzy6]rDrs9"E?ȃ-D͏O;tȭK30zst&~?|HB!Wt1~Y"7c#FC&s1@^p6$5<~;HAƅ*v|;}Qx.$~Nn-Bѽ/=`L/_o(zo XC>H,<)P_bXkƁzu>[/x,ut(D9]\Ő-#`pT][_5yP3َ6ApcK,2 R;.pbP '(%""CC4QQ'sdst~fF}3m95wsxue$pL nuDΔY4[=ɎB1ZzdL,iҰ0kz8kD%A7?8.I$j&]tVA(_}Uݢl ݀Ao\=NHT,@w /T.sK,Q5b>dz*a8i!X置J+vVRv5ȏl\Ke8jkM2NMQLU#"[:@Mή;H)2,'|G8'>N{RstP$^7PZ-r-F-F2(U蚏_-( +Z'QHoG]:ccULUU?q ijq [T>=M;}PeeJ}җ}R>wV>>>a`wªCѺ5 =Jc\dfO=VJ^I+`gmV.Xк3PFR(w [\BYr\*)h ,xRm*0̶kn0z QiPTK:VXp J#>/΍u2"Z%K)`XE74'ȽYȠDpfzp22(BqgPEwF%ZaJژIdP6hO(4<. .RJݨJL G#<鑠GmסpYot;^X< e؍JVf0t]h`(+E:G@I܌QPM+nFkg'P ɿ.gp`HZ1*yTw.b]*uvkRcFMZ.9ϭc]*|}D 4!P[GGXH%C liz>:ʷ3좕@y0\o%W%%Pr8In%Jkc% JGX[Y)J OF pKr~/_uWXو =v%x+XSS/(hOOnɿmy@̟D OSoWF:+3 /sPdh (7w1e L \*Mpz<ڕ@3(I[MjY\>|š~qR(1e8r{$v%) pOA"unz3|wՙ@cAH>!MglR)@I3ؕJPM$HDR(^ʟ ۹ʒuEv$Zᆊ?~3,E@eEI6&8j hR# Z# Zќ(h-85" Z}ğ0hm FAk#WQ \p5κ-; CsoasGAQDžՈ: zю ͔F;0hsA1)z@ GAk~; JǪB$_(huUw; Z0yu : gDXhJJqPp/5B_qP}Ryxv9&A\'Z]'1Q`fS(\qP; 1J̝r֢.^ 't-b'bWu*ZsG57SB0(J2sJS +RO& @.1i{lN1S>ԊGʠİyP %nÉ_L;H4LE/ ~Q0LxB JTC@Z @Td4lSֲ3(NRzC e}V\"LjwϜ̄ -N؈N+es;|8qÖ.e]2F_0X} r3o#u'W~@`7z1~b5)Ki ^8Tr4c@iXڐD-%x\T/܋$Tr-;b9v5ZWNIAtE~E%kq2*2+#G$7IUQ:[7 snRQGѬcEkѢXjta)6βq+Fw#^ Ā?Vz^W_㣿G:g4CB-8հ'b`/ɠ,Z앨O\o-ƴL%θb`*[kajo#1E2eQAqAa.N 's t6$~A)4чe(|F"jGE.ok.dM8ʈO+"ZOt^9?|Ҍ7 :#Kx.1DOWa Zl5Vq:Oq(5Sa.u"?q NKP>IO`5~NCK%JY9C]e%K-/մ,[1x=3’zza>hZ%߳Tϙά"288Xj-X{߲y[äR|DjsR"|%xh  ._>-pR?q|[0(pM, zW'0BƢ dt1 z E헙 Q9zDBhF0Hc@g\qbǢG_ot~^Wm.d7;uDm/7=1 MgU!yYjU#?k;uj f/w.dSxl'.*wU) Xqug* ˁ&;H3,AeI&bJuw[[-J^h7_6Y$9;F'U۲2y%}ghb_ %P tՈޠE:KH+%o-ث{nu"zp@ BS>Х~}EꤿڨCD`0|C߸*U :y0B<̔뉸Vv'l'!Қp[bSn[mۚp[{Fl{p~-F~-ʩo:n?b<B'[%IRӨI蛱ݙU. YlߢybΝ+ܹWEEJC+Ys[6dzp%qTJVڅ+YN+Yxh>+Yq%op!XJVRe\q%+*:~tX_m`r wKv/ ,A/dXjc'KxK8U:iy,X2du8q{]e6,Ԣq4ܲ $X 5F>kHcSAvqYQ%d?a}Jn&tAN;VD9}GrlKͮ@$"Jt"Դd{>?X@%608E* 'Ej־6<\nOLgSܘd4dtF=YEb'gX܆U)aU )YDRU$@JCJP  d9@JVXBJXO9Xi +^_EA` d:2Wa "JlSBSQ8,ϠKZ0PV(YF@I`v-&Jq(A}F'(oT[,2WIj0K06NB0 uƕ쨻Z_i\,{ugfXAvSg`q1}?SbX4$0%[@%=|qUEڑ/]}J>Nr1d'F)YA%`y̸xlJ09Wn7Qd-@UIJk(%UB ˰YPq}>A%l"ljȮ7dycJ ,И~=t1%P~oL 71%uEQB**Fs#JPQG w4J%%^RVroH-hpP:oA{b2=NG?ٝ$M_>R6Z| ^p>vsKxZiW@>r{RP+k'=kߥFam1 iu)ȥr1K g!+Y\bw#on1m~9Sj!x,~3;0 ?q EY| Mr hһlO8{SDz'VV`^Kؖ7ƾiCrHtb|)m}I9[-i>鹷ɾa.`sv{ڝhko_vb{,.-"0ԏ]B|ԛe֚PvT.4W.6c g^l40$5ismzy|w r {hS[lρ5Iޥ{4{_ !9Wbbdd핶٬)X[~CqEzAqzْtK:Jz{~N7apU?^#ta+zAyzkY؅d@ zb zAPD6tX^z47 8^б6Ṋт^2j9^sBC>^{9~{"mQd/PEKz%}joHGd/w ً2A;BD#{?$|?@(iW<^(x,`ہ_ w-RK~zcBu=G( 7^{I}["p/yhgGH&:^VV:^{Odz†#S^!^TǺ \0u{RART844;6Ou GQZ1iD6bkq!܋^#i)< BnFJot/|dfg{߅{)EK]݋.q{Ѳݣ<^nu{A^5н{lt/Z:^ rнKнh{GAr<W{{*{Iݫ' kKeA@~V(nix6diLKqrʁR˵w7t {E%rD)W_ h -˘Pa m; 66$@;='h(}YrpQR EB8nNKB~PU&.zGCC£Źzf )qUt+06 -7|r0ǗP -;s<*o*0Z"'zu6VY&z krFU7?b!s|EX$p-,[AP41d9 #x,X`.('ajlh/hh^\B7¢!v!] ,7ȥY"X7*Ql4fSNh4DN| /* ?`h#qDS'(K5cp 8 ƽt(z[p42MQ3v 2S"<|n3On8iFpJi)*+=cR#>I8Yj O{uG]\,H \do"<Zj\ HG={aMW'60PN6 Vu0-"(¿oQ;yǯg#2y `8&<[|9 ip'B?H#Q4H{֝)@yB4rG׼hb/+b#ެ塚aTߓJ n >\F YF5iLX4Ț+q8hY8P4^AxhS7-Eh4QIO XNvڒ㕝Ʃ9(9ˈz92!Ѷ6b$sΚBIOhc'$BnaCirEbسjH$hG ZCX4Qؠt9cѤB9/i/vV2X4!a=!;D,@=-BmBvnu^-S[5]1h杆My1?QdqQzZS\Lˁ Pj|A1Wk+ T3f7FڶB!ڑ.s|*6(Ug\.jZ$V$enDQ 5$VEq\ ~q6b!! ["SCo7[٩PZ5 ,*mEeR[U 6Rs/vI3_1,qNq$oX x)A^Y~ʬJWK^HZ l~Xیt'eH{ MOe 9=LY(Yy* U\0jH'a). 'f->.dEѿ-)v &ԛ.8:X >ݝXN. kKyN{5Qb|뙨{&u7Is B,!b+=R.Ŏ8eJ k~wCcMešش{Dhvޮhx v, +Βe'N]=2%u'/4yZWˤߺ4_f*sƥ>NJ/FTo "6z7 jd}YR& Kbm;0񔲮2#/ t@kNiϕMlq,]?S%]t[ڎ3ِ7ZJ1J2h'EV~%{6qXQNzE9q "ıEwcCv :i6l3IaACBjgn13]ܹ[P^OMɹ, kwQ=,hW]~qR.eh}-~wߜNV(!F-Rj B^PRcqz\تb@7i~_Q^=9ܩ bjw&1U$YuALe[ʊ u*"OhMI抋!CXb^ޅ(@;b*DCy6}r2{n-=*TiM-I۶tE ZJ#[FһkqE ZbnFca1FUDNt甍"-I퇒k6Z]}8LUCh*WĀ.!+b*k7Z٣J7=w)P<3?:5߯B*K1hjaϹLpH.oX\bz@{;U `$z~J !|nhގ/j(وC= Qļƿ1b5<쉭ıcO?f*f*inTy:&nR5ohn_- ˯ endstream endobj 4 0 obj << /Type /Page /CropBox [0 0 600.912 861.768] /MediaBox [0 0 600.912 861.768] /Resources << /ExtGState << /GS11 12 0 R /GS22 23 0 R /GS23 26 0 R >> /Properties << /Pr12 13 0 R /Pr13 14 0 R >> /XObject << /X0 19 0 R /X1 22 0 R /X2 29 0 R >> /ColorSpace << /CS16 16 0 R >> /Shading << /Sh26 30 0 R /Sh30 34 0 R /Sh34 38 0 R /Sh38 42 0 R /Sh42 46 0 R >> >> /Contents 11 0 R /TrimBox [0 0 600.912 861.768] /Group << /CS 16 0 R /S /Transparency >> /Parent 2 0 R >> endobj 48 0 obj << /Type /OCG /Name >> endobj 51 0 obj << /Filter [/FlateDecode] /Type /XObject /Subtype /Form /Resources << /ProcSet [/PDF /ImageC] /ColorSpace << /DefaultRGB 16 0 R /CS16 16 0 R >> >> /FormType 1 /Group << /Type /Group /S /Transparency /CS /DeviceRGB >> /BBox [-87.1231 497.943 604.69 916.188] /Matrix [1 0 0 1 0 0] /Length 783 >> stream xڍ{,apf5kc;=&s\䒎uBn'$I\\1#BDrKϾ{{~/Fg!_;-:0iyl>Tyatc#8EHAگ4398y3bXtC~a0.s$HLq |$Ň$zDLC 9\DC K#=3#1 b흝ՕoKKK_|455999111>qllltᡡw}}}===]]]mmm---o444׿}USS]]]UEyyYYYii⢢gyyOsss ;;;+K̬L?iii %%599$%%@BB]'Nll\LL,蘘hq "" n $$ |}}/H==xxx\n" 3GGG`ooolmmmlΓ瀵Y`iee330661d|= tttNmmm  ȱba 4555qpLM(PUU=TTTeeC@III"@^^~YY}@FFFZZZJJJ1 g~ [ endstream endobj 50 0 obj << /Type /Mask /S /Luminosity /G 51 0 R >> endobj 49 0 obj << /Type /ExtGState /SMask 50 0 R /AIS false /ca 1 /CA 1 /BM /Normal >> endobj 52 0 obj << /Type /ExtGState /SMask /None /AIS false /ca 1 /CA 1 /BM /Normal >> endobj 54 0 obj << /Type /XObject /Subtype /Image /Name /Im7 /Filter [/FlateDecode] /Width 821 /Height 419 /BitsPerComponent 8 /ColorSpace /DeviceGray /Decode [0 1] /Length 55133 >> stream x읇C6;n4i&{oG{o'"TDECTT@dod,f g~>/#|3}k7Yg.)H2߿| Or|k$g>sk=|27>vӭ?o~ywsϽxu[۶鳯3&~m/}⹗6js=&&fΝ1d;vl߾}Y_g_ 'w~:r%{o +فl۶=:::**2 nL}Ʈ36=l㶄Н9r$7733ӑԔ$ &1agݻv20  }ŷ? YP6mmL]y(<^wѣ̡@INNNJLLLH7.nϞ]$0/Q$-KhHhXpp֭p}!ia+v8_TVU]]UYYYQ^^0@Lޱc̑#/ >~ٳ ^1"/B֠-h}}aA#cO)M-9YWWW___WW[SSS]]0e IL>{^d%$/eB%BܱP,mK``M7o:|y߿X"*f[jAƆJR10ĠC{ }2֘t&]2Ub0y E^@Ze3ئ7n[xo7 O)NΫolikkmmmiF\NZ*P)C}A)R`@cDb@a#^ ǘBpC̖-H ¸_n]@7=1CFÎܚʖNSN+lH S+XURNX 0% 0'ˇ04氤ɲtR+C,>>]2L+ēL8eǂC0.뙗ߙvW*6Tʪo<ކ"ztT[*REc<'cb(0b$f7K N!xd0uZ5k׀^ _e/o*&>#̹sΞ=s4XoĴĠ?)"Ki2P\b'fAb(I0f^$2a <2kUWZ b ߯g\{`Lug:.\p\__sT #$pXuO€G1? VrvF ^Q 蔱l}P)s lH ,+-[K?~63wĺAYE=}/^xҥ/ 3ҘntPb(AQbZb@f28~2'GaVdgfHb3t؏ehBC O`$ٸ^,_,_g7k˫h *.^ۅ p'HTGH d VWS؏ R )_rndc &a ~͓EFDK/6o@A?%Șe/Yd1PJtcLܦs]}ȥJEr.G.1 2B :)knt~)WrNBƅ2dS1Ve2SSSIa$Fc ~I,hпC@ BaA^-\g>T#˗QW"CLV(?K&>kL'F eVcX`*E`Db 5d";B$Yv&zd'c,$6xDYze[9 *e9 ,[0_&mMjI:xp$hx_4dH "".#1UZ.ל1.N>r/r֟-^,Kqb&KT-l@a7fq7y~.=G_|E2.\Dm=AT>뎱(2ZZ-Lk.Km.*7v0Q?(c(*w(,p58e1)2b ?7;w=o_G}Ub yd;Ow891'g8|!}Ac}02:*Fɠ/R".Y6]9 yeIC%Y嗦&4a rc xCbb,X1sFogoַ9qGxwx\.]2GcBH{i¥"职 Cx1L1K CF5d fTH]2S]I3QSa ye(0f2b _1?9sYf͘1s ARzkǟ|`$0fEFcgB^P+d@`$[EǐƔ)?d1\C Mdf31uiROM1ZA?,FП$̐-$eYD6}B׾۩;kT'2+pcRQ`R">JaiAQԘ )@`iпVJʸs%`{0lIMMKB2v8La?|aV~J EF|2t8 5f ӧME]0_a[R5^ cT"ETF5|2 /ʩ~BQ ĸaG aim.*8O ~Gb3Ⴧ̡쬌4@Ce?GQet4KXHd[ݒ:6a} Z.([e-_bE%i2ed4ߕUƵeTu]z2!i9N)r4RR 0)(0.WeƓhT!SMQȄAS֟xc)),,ĊcD 0!1, qyի )SK- 0@`30$&N]@_!{1؀í=.]1`sU]c椲O)Hc Gq~;ށ-TBX¸@SÇTMv$N速rc\Տ%1 $,B~Rr294vlقzbȟ dVP䏇1`o>̙ ̰C0/'NoO]I_{>/=N:e5*2=H 0Ƹ6Y {<Yq&js&(- yVcJ̬ӧ{2۫ ِy/Hay 1D2P*>+~ycK:GuJӧOHsǸoc*:2]j4pK>/c(K`,+##3+3r;_PPPXT\\RZV^ Us>4lpXO{\o5bl{Fy9sík=#kߕeLݲ6p>aZpIi( X@l~wl9W\X}4'0>5uAk\mɺ8]"v1L-SϧrB)gmNRajeKThjik90MJN&EzlE3F[eY!P糥%+)*ɤ5:.\X@M>NwKaX7$( 5ps^T+1⦟K*/`#1 NYQJaX0--rPGi* \袮ohli?{:~";}TcQ0g:1.B<D%hfM1~;rF*Ϩ 1MqS4A?dqdxŶo&w׉C՝x]wunFAn엚dC!4jo34Jzjk@[Z;Nu0f )ƐyҰ%MtN:q$;LMqm&V\<$mHЁd`Dl(WP;w}1q?:5fKz~]۩N:jHu#:6ZV, colY-B怇 gaQ ><1jL@{/_zER, gSjH7H@ i[3팙25@Ả' 1QMHP< YtDMti?I)f~?8 u&|U>+5_iVNP˙3R #-b$F\O5d$^T ܴJTyh6[\D`EFJ3w׈Ho!ViT`AthGBq̑ù!'V%Z>`G;1QXxDm%%%4 w~qj;EQEg[Ee+ZM+Ed u.. .ZiNOث,o19aɕ}1Ws~5g9ϛ4f f'xǺdQэ8c K>cGФ#OX ! >y 1i CxD) 8}<'LXZ?l= ۤ@ET&8rӒf6ኪ'ʥ5N(B= z0?=jrUO? n~bʟ檩9;H )镎g,qֺ3N5{|C(@"c'W5jrC!R5`#1M,m .ϳg]ޢZV6Vkx}֡eA4_ ~XOgAN._O?+ghB'=6ϩ/'7U]4Q֎Q< Z&<}T4aQ]SN֟<)9$S4׆! ^8@HF&4;gwa~![ SNE[[Zu1gc4\S|W7%a\;KYДgUZv>UbrAM NgAFt5NyOW\ҿ39Cػ9P&@A) ᴱ=I= yW*6`$tw]]"A ;b1}&_}kQ/]sIr%<+C\j+Wm`l[u((s'Q:,*&9S5on^E-z`p(2v?*oF5'ڻΜxtB#5ǟxgi+4($j~Ϳ]vEvλQU 򢨨?l`Z[%)*R` N 0]тw"RVYZDQb|;ݘErU'.7GXQ{1+^"ZjTEO?3r=qgXI2rUN1zPB/&K}*TPǨKUNycEJm -ԛNzssz-($hXCr $o-tqK-/T/Mi W6uA.OD!q{sǣjWmtѻ7똭{tO5"lH_v81.4l~EHy") 2C%D[K.6n.y3OpLOeϩ2Lj$T4iI8\U:P:V@+M>M,<>}U5uDZ8ajF-e :"Oi1e/-Rɗ߱.=2̳* %K38zNc?`1iMΜq{+59*q#4̥UJdtLi>/}lر">5f,yF/(h>[:tj4Ym^ ~ѥx*{=/񌢰ц4+,+!` >mOL4O!.Nȹ"3hTo2q>uʗdxlV+QAPRdZd3nFXf9#=r,x!hU^#M䀣fq>=Ġxol8Vޡ%vI QaIzsLcZΜW<勗L$2XIң"j!g:}pVʰ@-Ò3 5s4mRC N&'u[Ţ"Qщ"gO<%Fq:)G qb5 & G B}TmELqPxJK.{r ۊVVYs9X_Pq|ў{moA6|dށy뜷XGu-flj$#/9Ⱥ<,Ckv۞ݲw WeႌĄDڍCrrH* h 3#w# 14rjNSq\f=#y'J@+MzYиLط[r2)_p%Cg,|_agd -%HK߅޺.ōcL3EXDY.G/FX]F8E[:&P J5r+=TE~2.H^ax^z1`Tbm ƢE·o؁?sg ݹsgll,<,a?dfe>>j-2i@j-Le(s(OEUR58ؼ˭Sf%VɐS%MI^2R .Hxi SF };i9DE((>O'!҃ !p۶-,<<< r;{`d W?g|Y0fh,NM>Y^264>L=zYqfviNv:')r*)ӲtOqiU}˩3/;GL%룁C!#. hϲ3fJ`9WJ8eU:=\R=fI7ZD!0(1x᣾0/ [xY Gxg#=ŠJTt}Wd Cu-9  n7m ޾#vw^djih3۱p*=[Mu :cX4C@n~f--xcEe5SRlKv,ˌ{sbNc&[t%Rd6r߂i>aiA ^0P4 =?w܄G,:ی).l$L 0[i&mތhqzZt\b֬]108,"zǮ}H16,?^\ZNi3чJ1ee瓸\> 2n-fWc}+7uHWSSUqhUsIڰ^AH6@g,=>| /-t ""דZHt"bwmG,"bgoG.9 GDRKxRYYиʔH&Z.21)R4LiC{vض3IMVjHi@jLmr♭?% B7 8P@,^h3i͚vjlj}l{mڣ{%Ìݧ!,3U$.9ݣIhD[KCmeɉref`DW)tֱ7G}qq5Pw'ZgcDAڽ(2U!׍SY~AF8U`ƫ6afRy!RI$'5̤I| B w8q!4Q9H"=cjfE3Ĭ` 5fej#&7x&@G$oñFACT*bnSvq]L7ĹkR 4࣡Dd(~JMNݹ=2H`^ M e(@ 3,2$+͛M@R˗.jм2f.F3ZgDK#m=g/]1k$L0>!\X0P[QRxpNfZ ~O쵡G+WpY,?[I,I JMaiSSBO?. Ghh>4"pO+]ԙe&k@. =-Mi; #:<>[vn Ćlv(ؠ{!f (1(yMi#?Z^SYpyst<֐6sh7:\b&@ʫ+-jk)?V|+ @X;ԅGq 'y<ˈ>:ň­(Sh&'xoʏDuMͧYwL$H#TÈjPMYlMǺz )$BJrRž];¶J"`* 3#07 =^ Ȭ4!f@  <+ 4 }/`=y'J*B6Jܥ58Z-tduyQ^nN:yPB)@eC =&Hm3UU۩x6sk~5)O")x2xhEsIЇAnTmtO˴sK"n&Kc2 Θz#3{il^VHN ʞh(U2e %-8!d8Ⅹ lɒ% Rr-o' J+jjVŧ9g_("P ^[ˋgpb-1\l% Dۓ9ɘH/pQ+IS'~N=[aX2ӴRuRAp$a$+7fz|( 9p8ӌsfm;3)Yh՚(2)1~tPFw N#"Fnahx|0b( B3VIJN 螏䋖 tH0d<g?:-*7P2O{= I":?ڔ =;b'}qʂQ33%epc*|0b&);'f ҌޤjOjΞwDn`p֬&I0[^&s&[~i?Pi%ܽgY2UPJ<% ?4K$x˕}y2k49+cM +6Xw-Do_zaQ1~3?E8f0{j1tEhE s.ͺtr֢<~ -\1@T N ,79!R<ӧG^-sIٿotp1&j ILC%pTs"6j( |AyxWG#&v}I94XWUaXLcG2w2!ڎI*v" p Y:Tϗ/ #dNmqi lj`KEVBЁj #W NGmv؄$ 4IԴJsPVqVSIBHѢ8{bcrО:q&Y'ӒvFoڠ* eZ%X}NjAMg= /YOJֽ]5pЎcXݬ8(=at\okmqnfzN2F@|> oܠb|$~=W2F>8f22NupS:ց_'>XcE978i&? 6$옊SזfԊlN.sڙ.H RLJJ@Q9kJOE.RBOu֮kIjH։'ۢ: Ù@ uqJ w?|Tce佱۹]*<^C,$8#l"UNk9x0'+u߮Pxא2+$jڵw[QaZCAeaQz '$@Xs{N4u>Y/2[jd&0\CpLls-G0=`BCWw{|wZZ~bH%d؜ٳf 3tQOk{:};_tO%)BMB05 dDߌY,@hΜ9s!y~~/[xR+Vڰ1pk0ҿ,:s)q4'ԁ&]CױdQJ{9v*p{| ~\SBJD"ъ dҵ&D!=uFof6$6s('m!;  ^fj_W:c0FA!v Léz}= xXI> &`IfXgfpzi)62WVUUW6vѡpa6<4f#40dmɘ/~Ϯ;@hͤ ;?^TRZVwW Kt;8eNcrf^yiD 1!\ƍqQx|& d}e֦36Y0qCDOxO_e޳L!j87 ܀gBE@j؈HY *K +"go|h.#(RJNIA+%̄mę3 f򕙲rIckkk ME͛6p^;΀պ%pСCm` #b3>WPxԄ=KxH(HQ79Qػ]5l^ P_QӦFH?jxae|z|X.Ԟ@*;Mb_ˁgT?|12DM !LN wLlf06L DBqі[zõ|[ZiIWZnSPhK` ntV9D 3#Vsmݳq@M1S&:S[7h`C]Y~V.&Oxйdõ9a(xr {'ǁPD}׾ԬCG(?z0;5)a_\eԹݎRUa1vudtjuHɌ'7f(ѣƌ=f1c118֖tǟcWʐ;ex$QɎ E&S8~>=?]?RpLhD[f$cnFQɱ\Ӑb!!0˖Z~ְ@s@xMVM)Xxѫq4`3ДD@G3$W=74ԕe x7|ʉ>.2uL.o‡`ݹ3vOBJBbG \揺3L #C!&&#G9rz&FtƎ4m +| ,*NNDYtI$D@Ic8ޚ~o2A6'q'8I4\8GݬpqTFtf$x%߄ҕk6GH{IωŻPI=Ic/w`^{yqѴ]!D jj;ہB9AC YY؟s^N=xρ% _6oUƓ3984g)Ɉ>@6l8QxCn3v1 3*F覍w.R8TpcRVT&w/Kcѧǎ5. Tt&7̞Kj7obHUC&V.%qů^5kCGII s-qK&“2>GYs̎RRsɈZ[$ KK+@x ;q+B݊.=p9 i0 v 4)Ovluvj{V7 7l`/6j:/W4m1Lٷ3Rvp/.GlڕfN;bDUc! yߣ9(<8n)"C)2՝}`=8F vl "3@ǐz /K/8y[hRޛ{郦6Nݛ \/ԝfpxZ'KP먎 W%j.jh$S~O>e?Y/J'߽>fSg̜`ɲ 5Dđ1[ny|yfO0Py/w᭷2F`o`o&>)pcܸ  !&m $86܈F$㏑^ I*5O7qF;n$G7be+@A n h-/# Bd@(F>,g֜=;9~ĐAW:BbWB|7| c13DoP&An=;f͹h< f8iQ"@|:R #esܣG6d*5 `1v]b]_Y+k8{m92G|M?mUf'?'s/^|7~oS3i셫7lJ2V.;uȡQ7 *jo0$o.'73:&Y{nɟ􁕞a&f!D9FE<ǎ0 5w">&0\jv A!63Y /%\DK{xh .6}t4&T-<'XF.^%d4 s^I1J˳lTzHN SLFEys& )VT[N" ";k?  lGC;~{ÏJ0oCѠAp$3x㞛 >NbvGXKf7\{oTgXe.ZhQ"9t귑&S/mFfĦc!wᙜ9v؆hN2@ԔgܓX'or6id IR u5S:#7aR7VkTm>hb?nƭ?wߟ_|ǞzA#'Ns̞6q|_x_j^y/WMu֍W_~ ~e^y~H!+~^0t IStC-f@oLX7$Jb y?;5TXǖXx..DzqMmfB{3H0i~;Yff݂0ǍʹQZPW(M7cl$9y4nj>C3&/͛w_7]>c?SO=82i>6ANaQYU}K)n$!RI:@I~fv/營0K{G'8 (:/2 %u t씗sFw/g_xykTd'Gcy)1xARfCO$JCm2LqӦL%y6C Vӧ]3 Ai2XMsY6͝ǽavVbp7ȁ#2R<٬m' A84(dd-Eec;{rG Lލ7xSal09#9TlTs>Hx1rʷ;~?9sϟӽ???` 8=O<$99ω=w/S4Nkƞ畧VI m8%$vQ~-w!@ 2VBrɲfl+yLdxy 4ɬ2p3_"2t&p1e3ꒇ3`3V..” :HvRԴP/`9(ȈN(F(h㌁G[xcnjqfle Pb:ǓkpN3  q혎[Iy֎.m4#6І]($L@n;~ӟ׿B~wnܠ<@ؐ  Lh 2bp?Sl]uR&9zDHY|ƌ2w2IkϙY3I,5H&AFh@ A` Mh5Dkt_!5z.+6gkn@R+t&JfˢOT2Y7لi,@IYeMc[g(1p͇r{0߾}G?я_淿;0${PoT i=ByiWx>̳=GXCgR5(RoФ"Xq7HV~`-t $MpheԀIڱ)#lsD;%@}@%S_dΙlTR'Yjj.iͮ3%E \BwZp׀qqڵc4<#A3zO=aSO=I)zR(". g F,B`蘿5R3|@Ea5H[c;CǏ!Q8x6;9Ctux _"i"(x?-<~:RGF5] %pѼ%77;bbv5@BxI!]@f6\?3!2 Vۼ{8jq ==#`LJasm&ˇGEf̘qc]# (-O'yJvɄXZ萷&35ƫ6 ؄L o:}?(p)Cv$z]$ ͩ)8ochS\^u$J,v^t4%>$[n̠wc Dr{pF27; :;DDO^H'zJxv\=k4KepS9Bj77ҲNHa aZgstzC9cTxl ѵ28$9yh",sP@ǖi֮]3e=XBhznb{}eGZFݘc_vX-Rc@tpC5uR 8}\|Y>DrWvo-7|˭ݎbƊ9558JD12ToqXo0r+BsM7,ʍ7~o!n~#3';@՛91p/8C01MGɇ{7<&|삉j耕sꮙz:|}Wi3 ,"4`NwٚgGۧ>8`tT8'SF q#^RatYQc_L~&Cb]`j@ xCl-" n 0$.wÓQ4tՍӭ|6PUAO4)9)G:c~i2w].596{0_pnMo~oFˍ9?3k 7 E8"诡;_4SW> _Xkr?\F{6&!I :#Q_f$`AuleV-6?Gr$GVЅ":Y`Nlڿaj4 FBEy_/ou\sz&6Y 3_dա=fl$k+:8:09!ltZB7siLm ׾~wo Mo֠06z1A~J~p"Qbn՝?' w,V&f>_5rl8DI3g8ԡ@ 8e:tԯ&[mǵ[[.{7鄓jO(̤CTsDt(6nN4]d+ ܸSf%f/~b[;^Z28IO\H!9m-Xi!!z#+[sGt`iN4F\^ϛoXjof6v87| jArćAQwwQ]9Hb"OB1~L=`J9H &m{\ l)~{lSP{zN"Gݪ\:J]ɽCL۶4F3L%TaOmΨI{3t,[iyۓX մx#/̖xzt8HښCq5ͤ҄T&8]sP5N2^Q.#OtTqx@ckיFpl]jy 567p#xaO?M&7EpAps=wsW:(AE^*&1^#8q𐛟 8%O>%e9&'9·1uܽhUkgrrq ۮjZ^33 s|lۉg |"\*8QZFqRB0I?ͰgM`hӆХf{gP琍6np~Fe.tk+?|>D.FshFBpK!9I@8jHKCϜE4P )hUUDM bSjb# {i"8"8?5-+>߉Ml9?C?O񇻜ý91SoUzq8umܓܳN75iQӍ 8s:E,ڶjG0p3,e)ILSV84-@nfk^mY]2h&,Ky2ݯVB)C3l%+WX$msuyVġF jgw\\|BBbRr2`'7@r# lBNqڮc۷L&?n4|&fMБ#HKaGj<]Ww99vcw''"doN4f4k<椭pWx1<d2ڞӠץoTsr6/'#?6,;A0L)1%tIlIV&L>;۸z*Kc7on!X芎\[B53m,٦ynv;xr)#c׈`ܢ?e jYT`Ψ\͑c7Fod$rpGhnPMEoѕXGM"zSIE8?N ~w';t,u>o5Ȳܫ<)G1 Ul(;JN?(Qkd7F_1S]izC05(5QdV qQ_0C 4v"Nfw&aFke [:a*0h4<Ƥ+SC yXijk8.!>_JFf{T"Hҥ **(5^L&dʗ)9Sϔ9W^ZhBo^U_KxZN)QlE]rEBZ9toƙ!jrS5i\ Fu@OƂw6NA6b;@Ӏ굁(ЖlԲ6Ma#=XФM8 U_um{I o_NT5|"& M7V H N;4,O/٢APF^n6DJA~نL :lPv"m0X/qgxƴZfKY WT!$ Njn~}g|g$Y}ryxW\rR4MR5t 9/P{nդUi ~1% yͿoa@)j1}Fش6m~I鴥= dRw4nFI?'б$HOlxYOҟ&\ߛH8^a(PRa2Ls7?9r2 +1t6YnؽeKݓ<-y_U嬝q.=ڐBal n, Ds^QFWʟH9 ?>#)AWw$5մ6x^G(NB-Sw~"U͟q$Wxz}Z*9nwXj6`GtCd0\i ۆbtHctUXB$;D-V)0Y ml"ǰ-רYbwPg5l+ͫCg ;&YVe.CzUf\F65j-r*%q| hdnXc<IeIB78~ok It9ZG)'&0Oco}[4 !G?h2d`Z6jw4u؈ccN+:l L5q@NOBeÖAh؀ )5Ԟ|Ao3_@fn:3Qizy#kZU\4bgĉ`C0<[¶1-$_8ګO!gb-(YΏ$&zÄsZ%Mڵд!:KSDM4q: /(x0J'?ojޑ"^-Uڧ%;&OR*E~2Ʀ+ Z¤Uѿ溨ώ]=Di<ީ 5ΈẒaQA[X qbcN}ݸMd2ՉVy=~2`A'5nܢQ;g?ؘF=袝\Y0,Cl葼hg3ix!}&JaNrjL+ގ&&x๐C{='7̈́k>lVTA4xiRz[ߔ[2TM"٤MZ$vi,7#iЦU0Qn48 Z]>ݩ}[UuرR#6}Yf+dVp9'c 6A`tqj@X;8׬r@5k[/Q X&h<|$zh;PuTP*4͡ĞFȚPQr5avę K }k#R4\֐a+E=(P% ğF@~Ǻ {?~[.ShJ}A6i3Hީ[ǰM@.ަV[ BGa3!p7*IMH~9z4fd~Κ8+;6/7ƳtlɷFg`^~fYڒ2S=Dڨ/ o/*j^{$R]T7<\?O[}>VwAK"O_Jmn$I]T:'}me/@pӚhQH'^aTmpˆ#~9r͂&KG{éA8ηDoY'z~%'k܌jUt' `uuC$䬵X+C` ѲrsL 7]gAgЪYXT [:8XqH*eY[6`Bk[Rr,2 }ω,n↻?Y:2 o%׿VNUb#1{&0:c/hQ 1ƍa'=zwP N#Sq|~ :;!+YӦAң[9ʀZyqo,j7S-c:,%)7 ТZѫf6 77^VW|e@N8m&FyqIΜ]tiO_xgM  2>_Ct&$7c ##)L_/?y]oWBM]:@v@(Y`S;4W"TXdWs5ۿۿ|Ƥؑϖܴ[2i 5T$?*$< =f`#xdQJA0/݉.)Zt\ ]A_DٱE(Tn͜ scѹ_ȋ^ܣ2Vꆼ~ j ݩNi2$޳&nFӦ DxjQf8/; *Y5Y+F;Y'>ۏsCdͧ JfWٚU 07B$58c;7~Ag '2&򪓰qgMN48H$cޠڼھuݰaf8OyfFu6O>9Ap@m~l+eF!qp]VSvpvH4ܜ2-!&-.@ @#J2UEtڻ׸~-u]k¯]SF4j 9_ֶUFN0Д5%aE H+fиekaӝaB1k'!)/ 9"rF@o&- #Hm ?`V޿5}_ePr! cB{<'$f؆Yn´ћzC4`x}`ix>j 1]T&qh6kZvWv<je::jmԠڀt[2iɦ] M8'z`7~``~AM#8`˻N`$8L8{96jwuGvG,s%IܞT}LIʴU,jU.|˴ k<~^w6Iȶnvs@ 6jDnGd8;=rPn,EQK/C}K/+^~)ztxRJI 2!BT6OrYmt'4ٚqigA+uϗkmג.՟ԳN.RҀ tB)JP@5Or&QgD6AP: v3}pdjNkE!"n \DCV0doVhSw*X溋Eq)an.m:rE NEE ڲލ RS89 /H/[Ez*jJ[-7#'?i;4iBJVۿ(/S 6+{-m ;;Y;5[ nW_TDo` Z7DFNhmRtjuNUͯϘ%̨ZZY:r |1ar.f&.g/7ջּұjpge [$fA @q,~&,:VL@ڪ#4|KmҠEP٤;2;>_kilH۪']]{ g]33;6*G Gups8`! Z-Zcbtf8X76jT"8ٻ(.yqljiE O:VƳU *ʥ< Vf0@( ?t#ɚ|S8i@n"s~mޑ/UeDF!>!𧳲ǻLfMFHEϻmOpOfk#9)g~RL}E!J~W&,YbQCm֭JEt8D7=48ҫ_BP_UM\f.?SәЂi]V@0=wABik঄7t%"Nw K?я~=ׂ҅(MZ:d/$1DeQ$8lçImiڸ&Z/]=1l٢ A9NdJ1N|枆e`NXa"44w6 gn{mYʟuCVr%U @h=Q3\¤z3<56?馚 il|УFH2آYѪzf|[K6t4aQqAPzF՞b 4xjQaknX"zrRl Rԟ-YK-6q]=4YaT4,ӰzsVn h=4"tERbDXzO=ږ24 PnjQ3OyGN9076}nWӉ&ͦ?n/>Ow "j.>,k EvIW*56(.-Xae[HC&ڎ :lwlbMbQ3ˇ_w&Q5ʤM̻TYXH<^Qשڬ\an6BI&6{]۔S, OˎAi|ey9 4^?k=u^'*-9ؽb_HIBw"ϭkc/4ku1oK: Lf 6׹ 9PYglSIQcw*ؽ/tmI@yE$s'l`(Ғ2qmE<(:Rv ?tin35)ThGYI(YsMpwUr.n/sYCjmXl$Zw}nׯM[G}!ly7jrG6r[yӬX7Bb̮PI&]Hfڣ"-6iiƹ3Otᑤ.1?.!,֣z1MTmn^b( R@ڴGO_SVwr#vPwVsV0$V%LFdm} 1"WTQs)^:؈t~?K2ڤm's)8Y T3ГaHc &Ê+ٰyٹ+ԁ ՛f.\OY lS;}^ڦI9Ps+?GŐ'8 J‡"D~?ap?00g5sbR\I {zOSs(~=Z5F_VpviQutlL\ S#rpBd61aS܌bgjƒDЯ͘۵:xB,f[|x],[f!n`f]Fnf#d hDqQJSe;?:gh?5'gx<PbC.EθQ/^}ګڡaЩד:a׿s~if|6LqԄ'jjE[64;lL39nA(p2u;9 a'MEjSp%6Bٴqs#;hӎKё)'mѰB,@=G}q  E㶐4?U$n)h8"(T*6&d&Qk(?@G>Zkȯfz:x|m04x8f4* 9 7swpbhtf6by&9 LƒNLhm LiצӮϩ@"1 ^ 3YΜfxX٪.Ĺ?* 3JUn!`jQ_)A/o[؎C-]mb\S[ ܂8GԮ96`301QQg3]|:w3Tw73'N6jaUKpIUGmƌc'`Ii$uWA'G CyJ86pNkUJ? =ҥ͓ .];6dOI%t2dQy_E&utM x46l-cQq=qR`zg& ͢@=0a:J09>dN/68vj~A6MpsTlD8~pcGOQ[Y''piBgOu^ld*p+L$O|S=ؤL۟ThD}9}[Ŵc͛+lA'rD :jk_-xc4<.K @>0krkQ9eyѢS5kǴ=nDZz @)!$D8ɴt 9H㦝Z@gAF WП!]*jSВk9z׆2tGﶆ)&G{bo e՞HkΖ揄:!8DVimEFJ[溁RmЧƒvf<$Çnzg;q4$t JRtojiQI}{m&~3qR5$~ 6-EşɦI闈59{IKMx,u4 H,5}wB߭GItZ HckV:5Fl٦5bf [N6x.ִm;'l Y щGkPxeS4ll.џiΥKNE+ GLVnG EI'Ajϩ+}Lr 19HŗMFAG$gpZ@`SyJ֜A0ktOM@5T9!:@'hh9z#Ur fYNl+sAei ַtrLޤ{=6k&'G t?0Dlbтh&q5ҠGՠ%ouk Lj4C$ Gɽ?/HTs\xCrYFFP6^G85q-|# fA(6hь=tFB#0NZ;0 ?sDG-Ut<{TOgHZC:L̤=UJ|sBf6fcwf5/KkfΏ>Y6bTU'fM7RkVQ;4p3d]jc&QbȤ+ $(SH5Rmm.H~۴FK. g7Agvlx78ԽUc8g%pNG4Pr3T\;_U:5N]ZRs&ؤLpS@Tjih+  Np*ʹλ]ozv6W`F`4]iQۈ|us|cI[ ΛN9^,}q}(GЅC7l[0H,g,ƙXhGÉS6 ~''~W ?J|@{#r+swШ)!g8k23=& ͂ 1,dcI"c=D#mVfW "`R!v}#ٯcͅ69oǬ'M2ր)4\8_b:;noN~ ?/{5ffԹ@f12WW#ISF=-T0n C5"F[gNoJ+[L7JN5k@s@TN``qpM20CGFd6-6֡RsI?4Q@'p6hX@?qድtirD~7UZA-*4pxseS7wy g -ٰg+:Mpc;5j{a~`;V6Qہ-)D5&ьj]`4J uiR&Kõ(/equYkw-;]3 r1! 3^G[(7吝Ja]T띳kќg&7Ըeq|F8}լ0ȭ'T׵a_i[3jdԖ&)7ivWll0@hbW8Ĺg\m ٩yvWEG~%~}Mqd'BvB O4-]9#ҥ@]8xv 5V̀Zr%{ިEMN 9,FgkVqzc 7~;7ڣ6M6in#M8i]ݻ:ʎع(HBy#u(S595ǚӏm|kej }6tR5A]j9H~CUm;yj\N2Q+8讹lVm&EUZd3X Ugբ-G`gڣi]:ܠGӊp!g;OGԱC0 r rT7jr Hga=?ìg|ydnk7ߴq@MWnmS#}pՆ頃sa@ZָQC:3ll#W{$݋SRZ ?#Fn6Y,դxIE` 0ڥ>Zp_{bI?S^^E6.`cHD\?$ Zբ9iyShoJY+N[Cr[f,M5rjuذS .7^ol69 %F:瓏v?WB2mBk5f&Iȡf)9tva&GmbxT?٧7RJ5P慮57\W5"LXO\Y5h+s=|uq<HQ1=M:Bxg҅\ L A6>G̀{hml- 69֯mJZ9ܰI .R [&?%͠F-ɆgH:vBb!"'Qo1S@rlgПGfImNڦW'ih-[QKˤcI;#vm$ B#ACiIQ5OIԚl O'A{゚4\bS>_{&#NFZ惛rz$Geisb6l藾pg*%M2Օ(T6X?m8@W#6<,eG+6{ˌSѤ4Nt<6hDyN0\=HvZ? 4M򵆴7du *l K;}#V ڤXunYk8ګZͶjIFv2 iPf/WlF$Ӥnw v,5v+w~2֠Ac5{ ljͼM65ؐ!D.:If pbcX޺ 9>lv t vA҅r˛={EM5M\y,SbRs,4@ ;nԠ\q DZݥ)u 8 d)l/tt:x"-H;`'F5!v5Z>T`lq͎v9thcs-$gYMElg=\U-"Ѥ}\@s֖Lwݚ8;k8dQ8fr-O$sRN,Qoftjr|STu6:{@;='t20<U썰+܀DDA4Zi\8uq7l8ȍoȑS29?&8Bl0^|ok6MOyQ@{( MZF>y jy nԲ#_IZq{mG^l }F%Z5 XZ&N#̀KB@5 MWth 5#zc`eة;f===xmr:Wn@"a- 6muLn@HÍtd.10=X9ip8,w'̨VL75K@ƚW@x76o;lfpZ?R;s0b4ѾOkn5M]fv_c]՚S;z6lRsqS4,DŽ9zlE:ijY 7DCءsvz:oj#]lG tbQ#Nlև|3§cJ: z#g)Vx3Vj9jA&^BnF%7pI* {RM6t4-Y 7Bif ;n*Lѡxl\xPsEi^r*|ozp#)PZ7CfHL=SY 7XGNr\ v{vI{nz\.7;1쁅'7r$*џI YHwdK.xtg]h(5Js3֛f^j Ν09sx 6֥Y@%܄0xY2O,Ԩ#^Ѳ^Kk U-0{b q;&'5ycH7|ДLGusL$7Q<0Óf*ӧ,u9@ pfz} -~Zjvڝ mFz9s|MIK'jRPtWՠFPhwis$thZFB7fI:֌9-0&`X [ex\i3CML E^ZܨD3XK.~jp lͳggqMΦy]kky|njܴ}iˍN t!.m<֦i"n<-q3BYqJ]ȝQjaKzkЀ[ Հw>lI8{ңfn:N5Fؤ34\:?ϯb 9'~-XCj7N#CA܌&9'7pļYTޤ *[&g[tqgzXR@j6(}'Ue㰡6U9&npͧ,e0j:jqnr357 NU4O7crt"-ņbI/-db/ 5od1p߼^mmیciSsmiͩ6a[2jc @3AXjBSм{zAg3jyD"6n`3. Ȏ7 93U$Fϙky榞psG FmJ]F LK>m6K&r$#(K,m@hRRvLRUϠ| :SV>m|CBt/\D:g::?68CY ̩&IYLvt]Z۠X &lč$B۽ǝ7ibt䉓'6ְZL4vZNdGoZ!C9bY@ cxqLֵٳ)fѐ,1ժrmjË'il9`Ű68<0}Tah>8h<4[ݑ9Pʢ>xZGzc40nx6Kv+ͪT͚5tB*>͇N# r24YN:RҥAFg~ @JBCpM5ؔO٭XnZ"nr9ޘvc.#]?fl8/`ڵR[5[FCO&-Fksyw:hlފ(rj4VωlNxnډ𥑃MXh&jL( NhU)[޴57 XwRلjʛ4:)[pQ/vK`y+\͛HVQlPjNC>A <'Ieipdޕd&1tilOظY-Y]5D  R,kU]bS@sF򴨞PZuf&&#E+pf%=nf%q|.xeZː1ꌆ+z@c#Cj`IIM hΘ+ JSz3`@i؛ 96j(0aB jRn}8̳m4mm;zڵ5iiԨZ`}^Asy"PCM /VR4.Mm:3ڐ,}=+i9wOU׭BL7ig4L{@ka=oW!.`hk4ԣ]N>_$h#OLyZnǛĠ,7OYsMFRV4r4 1~+ %2j ܬ*Jh-ڶmq N)3]skbؓllg bKR`#KMnc8CjA(MCq6qIͽIvi|IlNԹ&I9-C}=$ݍ6 5zZ>,شutL ;f; 1{ p(#P vSg/PibwX f'P&5mMUM1xeך'Hl̡Q)/nl#pӐÞ&eR:wp fV=,X`}TvJ]=dm}SYhOZADsg͞5/ZMyrHl֝Q1㷛 6ڣ^ w;1}g?٨Z]7vl4X2R#hAlYiD{P`BMyp 64j!# (&ݳ;8eQfD4'K}Jc46ڡ. %r}lҒY]qO}6ąZ#n#+:Jpܚ$naЈR/Dwн9٘hU6;ր,wCzdFuƤ? eF08Pج] m Z[4sw}M2}Fظm{/ :q gx`'0i,hDwL6bjͼYl-}} HQNH8;\#n*ѩF=piTK'˄JZP v m3,jNi}7D`(WMo2L$hi;\a1w;6AΥo妪6|+'KMUlAth5-(ҥ (xI㦡N5"l t)7I-L\l2M|AK|p N)~&-]XM7TO3lކ3H S;A` ũ ~n5rkZoņ@)~& ikkrip cC5.E;y-6EOp Ӂ lqgkdlI ΪO{_o՛f QH׸T[ mDg=-8 FhvϛEd5Xp&9wN: b8.\(lWG9tjK]h`@wA ܭ /lVJ6BMkk-vDq dSwދMcBapҧ $&S t@F5R6Rkt 5I,@39ya.cH}"=/`'NWg 4L6Ɇ"x{jpK8!O3iZ F.3Z4&՚4ֈq@TּOk֤vZ׀k T d4t⥓dn }7(]>ymEۥ*p=s|"^⦽gӛǭa(6 56ݒlD10&O ,GD'6S5Z:8HgkDtij!|`/JN{G$LӤIPZZZ?G\=OR@WpSJj@`8͞}y&jDJ3g Z.mZjm`ӀY?[4YtsG~fݪ톲TMg4eƚDhkY]?U} imGA>g p0(jWZj<ɱssiء&8S2g~:-YUv/ 6m+ 6IDjX3./6ja;ņf6R5fX&u&pٳo_v9fۀǪm. Mlc ›ܠ!^894*=VĚXllk!Q{HVi@Ig}xN5ytl&E&JGaÈc4֦B Qy^l'jahdZ%W+V19jRnN6P3M m7p lhz Ϟҩ"8Q@Sײh\EN6`vhs++ЦN32L$C&c5ؘbl6fq¦|Ka5pQfGApZ:f]wy0tZ?+ӎ6o:jRmPpnG:jFo -lҚRl|ky:Fj,Ø>pa<ۣf:CamM۹Bmi暓'Oogy_l+jd YP$p2wPO&od63ԬMCDN3ٻ\Μ'7Ikiii:&^:-r/R8\h=ۤB_>ІqkijvQ잩H,+6-RmACܫFTBF PXklΥq lքsZ= YitTs,kkl͊h(Of>Sgc7Ρhڢ;@H]bS}=8S4N0ILV,Fn%ZZDΩzP݂}M.WMtr6 E탍( v3n$"PfYD̓k"pVfz-,GMsnMMl" ΑY2a6b$ Bԗ[Od`y_")AΦ;Men{eA"mFL@Er2v3t@Z5 Lg<+m8!6agZQ/uVk6s٤|Vu䜚maLԨfZk`dAQТZNԠ`ޕ5VZuPq6ri@ `{ 9-gXḵjIN35\y_g`i,Ѹ`-95fN6@Mw ndGzhƔ&ly._ng AfMĥspy1 qz,` gwyDi툠Qc>&l&Ƃ:'ʗ[G- F]mjiIv X#ˀy]-j :IiC5#]Y]RДwK#n1`"`NDiw:s9+_n׷y\1SG[F IMth\-u&q8c!; jlsM*wF{ njb :48Eb$9s[nik\>цhOMg=k*t \3i4݂==זσaĀjYK՚Yg/pydphbz& /04 3|}˻5M['4t6FF2CTc~ʪRc 6[-Zl@ Z = h@-ڤ-V}wuZ3+ZCak:>~U)_nݗkuآ j\Y)v-~}[;jQ6!'X hD4hJ p@Ul׵[{i˜Ѻii#3_jdx;jyxibӥl*Ԉ=.Vk`S3}zw& U&hE`MyG5a5RG-ﶙlzg>cqvhcG0i'A+_ndaÍJxhYZ@tm>] >> stream xuXT7hc.ARa@cJF$CPiE`A:Nw{}}wM\h^)*.tLL L_@̏M&1q&# ] mVwwoB-Z`"{`k @CA @6] ZqR07s]V2pCʹ8EN Sh-sxk㢎C䛛8̔M9JBڝ!kTC9:*+"m6M"pugBGF+ uBA<"sHHQ;KUjI98;~_2(ta#Cz'ņB%$4B!4O䕒>; .7 >7RW4C^(FCi $RpR@p|n;#E ;@Ә^*T4G7 + ަ ayv.izX\ʦ# CM%}]yhLcuPkluQ'vbT7a*ݙtQ9(LrnCjOymIۛ<߬VFY %У46+OhM%!isH@F^xn} Xc?l}!0r,nl'2-+D\a n6%[^s θu8Cώ!]o[]i0ǡ;Vmi6ֱ2*l8k5C^~LLM9Kf[ZGp9y·l g@ *"9[2$0B95#RL_pe<=jwT27ۙe*Ĥ ٌ vaQd؄1#\ NdѮaTy$mh [€n~e 夂޴aQSW+|z=ΪFwWg*Eux"^;_j`8@5 k$Pw>І=>!N$=}ze"?6iK4Ymepͼ٭gD#09c`G bl!3]LtpIc6K*r ۑ`$;1}l5p3,v Bʮy(bÕJRق?&<@:-ZHfa2j F7i_>PC<yW-oGez]yӜo2M o^/lE|S|ef/(&.Zwܪ 1x{]ʏjݷ=pqw{WW2xj?{guI9r?-lU=:Cg)- ]݇BO5Z\610wFUQڦ0="f ,Z-tMcU7kJr=J *K^Rn:^RJ5N _mED29̈́l,r;PC<U?:΋L0'Z8D^4 )9PC;Yvd^;~Az.NVQg0('#'/dYZgDH]f]7wHB@qa |F6?,)6ȠM5{l|װxL")p%-IVVIQyK38uA-$+èGUxΖurĐ 8W,s8.3 scGϰ?>̳9Be<̰)nbud3|'/^,o }gE.iM\F&] 9Fmܥڌu,LUALXh֐"G%2㞃L|"kZ%wƏtP!,_ޝͨ0vKu2vP RL\B^4RsӖϖTCD :󭙆ÞDC 6ԖUQrz(L_À+1¯PJRIy/]8:|p97rC#'h''OT(&LUv.01>7h@QG}FzIw1b5Ne#a(I٧H\Wv8D\aT5MKrifLf;2Tj *a6i!ds ]FoQ \A7괦Qs"T@@Bj/YAY,"1(Aq`@xҦLJm4Dq9?eHV:fb$(kKqTO;'f S\߶*_dh!7b;KQ_NhVV⬤4 \ObqT5>QP'(_јȌ7?˯#җ_}t(bp>t.x娣8<[ڷi>`%0R#seIH&]OK;aiPs C/DS5L9A^q[W뜪69Y s5ל|m߼q {nƤmrQ}TX*UY+M JW s o/x7:ۙC G3G i.ܛBmcl KrX\psk2# .8d~2-ӶgLaևVBwPiηZ^Weْ(8lw_#K}z )zDbjZ8$ 2O8/‡9i&_`t:tB䟛uH<+ T0]":3,l.(9=~Pg>`4'`SʁB#4ʐ@븗א40f^騠6XкħyExV$;{WFׯMY>9"wHiHjn so * 2]Ȫ!1 6J[O?uPK92Qሸg221Š M _3L7#:0sށLFxFx=hO, {P3ǟVcD z=Ed0 s✗M|khPV F{P{Pqk{3y>yqÄ48ǟc(Xc'ip+s, 3Q%͜ɉPpΰIDN^:g% Q8kRSb߄8%ލ0똞{dOzWyTg(V ;MmA\R^j sVCS ІLc1@I}x[A 9%0rXw.c:mW0#7`D|CD y~pzQa;R 8*=7`ࡒA ^&h#:HA:GFa ,S;%O0J9\!,F=ށjhdRga堪J!TBڨkjB}J( Q@$\ő21;ax|[lC$İK\ʶd ce췕R8: <LE$:CI d1&iP9C=FY7kЁy.uhl<~IK`|=c̿;~GyhOV:KPWcEEiC7oQe8.fM; & ֹ%庋o% 7!;ї:Wx'zk =.a9r7@=a 1Ҳk@Kaq0bNaNgawv'"9Q6-8G=$GIQ.>ѿ-1,1m4e 5"H|XT6mI$!T/ j8.Ap: a"d])'bxyyYaJs.ЧL-W!ó={ELhTf̅ʍsA_]]2dr`οw(RG{_y^I!LjMPO4$\f;mq{DIiW ^`:q33<iK;#*^K6WUKD^CV2ʮDyIEhTGT"ٞ@GG*~u{Uc>ǽzrUE\j ͽ2ֽocb Ƽ>4NxCGq}BޤnM6V9ۆ.Ⱥ)M/AkYݔ`Sdž [,ʛ mȴ㨿( ܎ WX`y?"-[+2r0([aQ5؅]1Zt-IefmzNӔR YjqEܨE;4u#za*WSDd!X{h$6_;zԿHl3lS 9lQ-kڛp%joq\o#F =/jme1 "E(JO^Rf5W?iktLߊǿ,o. ȯ1hK8c Y>3EĽ 9kMtejPکik'[됢ѕmYdCFNrZȸ([9zt+j}^lWZ4FkS'QԆEGgCrOإnU k#ن~Y--0wPq/JmA؆`Eo@<'\| 2zP MTL鎸չ_gQ-(/+/Ag_fb+Hαno)ʲ[߹USza.)&&"Q %S"h/֌߇oIrv9"n+A)m$'*^Y6s-,7%HW0 1\r )%#$Z+'${5ud K:^5wp?-J5ø-pdXq}u[7QAqʣumc Q4cۊ~!Wdb4'@6. SAmT׾nokٻK@~)M ) %3)-~ .K¬LlQsjSlD#Vbubâè:=.M4XN>mbDC,ai1?A屲8?f٪|AESvE.SPםMfSʦ Oq7y}vFOHU-֨ƁZ"zxVMwRiA k&OiP]h(93dm/ &frRA?_8N7"ew3c #_ȃ%+2jx@0r|l:_A09S`,h$#W!67 1pipZ{lA'ƷTͬENr- h͗PI/y%B|c:)Gڑzh%:RX>zBv?vOlq 2~+d=ATUcjk91k!mjFu*VJB/-j 2+|tCIc[J-t`brd>sYŷSq)꒍#/CA zlcE&ݯ Cưa*nA61p3Ər xl|D+?BFuQmf}T9-ua~j@`(֤s7rUԂL+c/ҡi BϬV&QVxt{2 *NxZ]xlI^CÕ _./U#6dt EB rĄ\z9WU(Syme]s+b9'dJs}>:aa:O݉Lc2Os".9V 5֏vy#fk--ꉑ',YRQ-U_0񻝽?2Z*#-T ꗜw^sXw#8P\ͼ05 &:l_ֺ7Q yn)O8t+d;%Dž$ /qU{ݼ2l5Lʆ$½qZ>JM,@s 'NTc:l#ɝ#zYيN?Mϋs>N-*u{&r XeBw swY*$'3#Ζڪ+X;-F4i*&85G(N19%a9]m#Fk@G_z{G/+ߞjLns!]qf|5q&}5Jr4*b]#Xի0]W8MjDi `8J{6Z;fPHf4Ec@IsQk1ŀ}0Hc4aMq}%6luyOR1Uf9%ލu{s Dj&VUK;y?<=2^vxvXu0,5< @XaH5ʔls(Xԏi;ʃ= yTDHLO23:j3[}-!mGgDk@mۼI}>zU7(0ijv0>K 1gwcş2kbg>51 ƨJMG:?@NժnD >lt+ +Rٚ(L՚LhLO ͼ9N٩rQU1?cQmNQ^zwɭ8 U]* LnMi,~XoJiN9jC(""BV.ЌqlvJR\ binZvx+UA1rm")9xn3+5.=̰'A[[)ە@{˓iF^:H B,EGi5!l!]S~PU 8F*xgJ-M竲OgqGtUaC*4T/.7tJZ rSŻ5w(X4,l+<4VZm>#{˥xB@$.|\\ '/g)V\AϞ^NEC6]*n$SJ'G0DǛ6Ӟr0RS3Pzc6gF'mnQ?U:g։ͭFupp{ s]W' l]HXrw?cS^6?~Fi#ѩ 18[]76!QiDس^ WUUHڐLl75iϼm;Z@o%[H eOІJ1biyՅD5O{~iǚEKz0 }ͨ)g:T7_, RR(3/nq6ٚlԯ?t{VHHǩR~jM~H;;teke¡Yc Kӡfw99f2~Q+2 =wO\xpV`}҈|zx ]%BdUn<foz1HPݏұwӽnN">yV yRМ<yȷ u/62Uޏ6T58KJb]ȿ#t#wςuJ'|α4+eɮ | ǫrprE0Vm#[t1Y/,evW4.Nz{Z=|HG*1KEeiΧ=poJ1e2?mmwɽmW`<3vԅͷp4 F%GI(3G/H$#ؚ'+aOXz2 GÅ}EaV6 ~9s_#Q6ѻvR#p'쌏k>*8#.򋚝[r{3m=b#1)F /С?~:'\y̔@tG.eLHSHe/9~5d /Ԇߋv{N)sA/.!~'B[dGAF[U3(@uN!4 ;]9K.ma[Nc)/eBD1,OSN<(5|a PQ؎"uLcqNi8IL=?YXyckv\#~"^hGfV IƓ'ijU7k;J|ū m`V'(ꍑB|nN|UEB-P 9hm5m!~SyS؝=x-Ǜ~G .UBEmʴ(ܺKb'Kgph~thLjCtQCL) uG*:[W7?'!hrEhXN- Se)٭i9U>#1(&>dZjh:ϐGD|47T%2ʽJ%"D1 n7?z!/3YƇ"IⲅԜ(OJj~BZn&ԟ+KE1h)TIc' vj%❚nL`>6G2B#S%Y8k*G.϶dw*=MdX5<25&gں0@ȳ.x.c&Kna/bҧOM)bc{}k6gܓuҺO鷳90Vn|U,/&OF&a}(*Ǐ21 H*PS2vt|29i0G{1*f/iJUFPݛߧS5zs|:ZF:M͔k4v gQڮb5Tnbf;WL';YjQ?{B%p^m%#1ʈymm]¿5[Dc;PO{ZvC‹Kʌ -(|8i]FУU=Jz熡mbkڲrzqvv㸞+V;?)kXO T IUW$+ӮY+vmj5TA8t&z\U1{+GtQ,Vxǡkf>i?7Tr޾MTVf`#k# Ct +tXg2q`ڍFYzi7#Ŀ-MEW[=0RQZ4c:bk%6OS`Vۿ:/ն^3,e;!|+bH ̿Pq󤒄uGXckWAʘ,S[Qa<O5nm/҉}W^K/R*nl H'p N7puT,_ El>W~K]ϝ8ϘhJ%J׌%r90).E!.iTT@m4$c(%F\$E_*ĠC':7#1,g$λL:w +tx}{[~nIGNk> .Gq\D0f~-IR- 7?%ܼAcȆ<-Xo׫ /0#mŋ٦Y(4Dtx}hG[T*]h#VoW#y]2 %[J x=S BԜ 4qQ짆2\F Q7 sŒ߰'v> q_ a Z6Ĭ7@)7Y=NsrƳʙJ13uϥ}=ܡ|Ί kfPL]!cX؂?ef2t+斌YR\KT3d-b~}ْnY|>F|x%S^ݐWCV.yۭ:$*B<܆W3X*T}\&~tv'SR߂nH1U:o/HO\]CٱIe|bȯTI+Z9ԛBk/(WkS O}Mq=.wN+NV)S۝9깺|ֶR^V5 R{*$/Ͻ%z.GskcS]EvIR:~)7| T ӅP/T;^y4}b`?'8sUÍ~$$. hXpق$BN <,67wͺRuGiޢ=μ ߭Žn),O' X}cKGxEZ޴SxFM;ST¼7O3W03?~˰Zןvq/2J==JX뜣;]c2ǙΥNѝY|kҴXӒhH;K!bUbG?U,6컂nEsC#rB'eJQI3cBY:gsC:k`=XtpC󁫱G=5 W']+ӂߢU˓P4qKIy-S5ퟚ _X S\sˡ?ڮ/׀+kֈ9GQ5Ю3޹{ɖC峳7c?YkᲡÐkVS<A$>3`A2~q_r34"Vg~bD\:?/h#[XytTC$q_(d )y|iيaWgy\v{`u~]J$_dӬ_Me MCF\Bu@WH ְΣ>/[j?*J=U@GI7`A9jĜ1RW? d||mH+\,#ڨ(">Hw`* ~poYԯ 2ow%m6D/Ѫ>R!Z@g:pBAyGM.k|6q|WqoYzC & hfZ,=+2'g@uAh&Y:Al0E d/^j.hPbRK#S'?w3/Db$QgO-u\A˓ @@7Xd]N DyRza-7j˅]nﴙ^oIcz, L<f(-=ɿſ [3yY]~-A-vcoW7s'yv-H`!w<+Vӏ@oܩzzj>Jѳ?{nsc0f(<Fijo^|,'!5"n4yͧo>Z^ѥE:?3Sy' [G>IDAȇJ?Qx\21f$GsZw_E]_jW5'5ƨ1㋺g; `9(5a/GprGN%T ZZdJ7J)FڼHsx8{DQ$XêԠ1&4`MBH]؞9'D &ν"!4|™{Mc`d6-w?3f} ^ @ ٣#C,<542)-oUMbgW QqD4'К;-ы6Bxoφ0ޕ;q% iVӾIDL' $1M.%|OB<b,dJu=2|. MҔH>VDr'rl$?Haz྄_yƝbb7eTRWW@Qʩ+R~Yo0h`k@61p1<~kOCS/mIFEC+O:'rK sҍX]xLc!}|{(#z.EJq߂vݤQU[}Y?.]ڋuH&$5g3d"4@_sFfE*W殽^b:WQyS~e=Z;)p&V;v>Ġڔz;ֱmYYs7UJ4mتp[rAGqPH#ynC#VWIG9<  ~v5?A+ h@L*%?5LH\G۴zmܞH= > T}]?@_@ pNѭͮB^l-\gp;,|ėDkjxl࠵u4ىKpNWlRhf/Kpl)b{uudPCģɈk`@f#mX$%l^]*E1SO.n'?A W a\{fİ_2ɧ+#n3RwF^w{$\fɫ%|I#L'n^Wa~(ނ(L^0h ;. OwD}7mqϱ)P#kV+LN`ע; Q5=4~&ҸVNXIJGs!Zc0E3j?,ĩ́CRi#[>Kfdv,yqs `Ƥk)B*MnV~@:+Zbg|@kLR37 _4j FL*K^} ik "q, p ٛMW" Pzn{E5-t}٪݋ ha$|A,,n(wAslq;P<*_2 %1(i.M$cه+t;m_ ]cK>k@Dd% (z(`U7]~~^@O>XsZe^_/΢X\uB:3 +VTiCg)Aȟѹ|nC(@\w# Θ&N]t~kT:E -cfngs4Czk?sܒ*@޸={N%,7R۹ ^8 w\ U67 4" P2Sgzgfj !Qz Hݘ[=Ají6׀ C>%k%LW*"$ĩ7|Ɛ0*eT8^uS//W5nT|w'~ s endstream endobj 57 0 obj << /Type /XObject /Subtype /Image /Name /Im9 /Filter [/FlateDecode] /Width 798 /Height 560 /BitsPerComponent 8 /ColorSpace /DeviceGray /Decode [0 1] /Length 4630 >> stream x݇uL$B'"D!4CE""}],GNAEVi 4BBz{.%e>~|^Ԛ<8e_:wj|J nk҉nQnUAoc56_7g?E >/rG9r]YO(7!}XW 6J.@PG*!ImX0qI;)a8*#y%ŁߧDz:0Q~Jg{ [7~i?qZ Ak5/8$9S n8Deg`B']BB|G݅!Y*MhcͥY,KWҼC2X-o=⭅V &LJ]Ŋ4GGEC-,̡Lϣ:lS.ϖ"ڂu Dy~0Q"omf`pJq␴GX<{02S+n)oyEOHwfaT{d Q ATpmeXERqRB0 [u!ʫ|SI}XJm[8$ c ?$Q^ R Z@B,zaT,4S+&OCw08XN/`(S|n>C"R|©R=?l׿ۏŅtAXdyg^O9+yЭc.? :e8BcV8=e7>e;a]{\mRCo=fH xЗ m,7tZ{~Jz'|x8D;P K)HSЉR]weա;i`[v:T{EV8***⣈~GTCǽ D%+а.]3D=NUQOTDMGG&k.u>-*@-懀6ZKD}gS@k E@om_-ڰ*ZRvYE#qo\Eֻ'_-Y[T،_84N :hS+ -Wf13V逥ˢI4+u@M7{DvZahVZe6q?u }n1-@~mx#fu O:ouowHmvӆHpĽ|C7, Kp96ԁE?5ڸqԁ"-M[\jN G=>}-u%;]y:F\{XN>̏\OZuo`M0)]~f(Pvu꓏q0S ۈy0F<3a25faYZFx`ΩpUq0 [Wy hWsQ}I("xuǙ7D0uƳ/oq%Qah&'F1e=e*f%R:i%;BfE&w }W:otZ>;BFTm_u5 kpOSӆ: LuYҾ%: R^ e⿥ oo:Cx^ӆ?\jCf>όԡ}C7iNm}O_FR>9t}ÿzQן{6Q>!g:u{l§);*QڨNԡ5ֻl##:uhԣZ\:4tJqCCzPF* m:uhtaoE?Q2T؞:1OSiJԡ$lY,T'u$$niR*$ T:?Wm6Ǟέ&8#BumC.@R車 y4ul<ɣTz3N? ӆ\lO~ŝQ`y`: ^]|<]ǒ[Ow9s]=KS0랲,:||6 :|xBl:vgfP7ig ;IpLJQYCsPGIkk40K,Q]l{yRȶWb1]fyESGM8KQ)g?ĵ6FN/&ruxu3Vf뱪\Pho)9 uXw~n$ řNvaKd Ř=z8[Gن=}x4{(ԱQchRWP9b:zd<++N(Vlm.%Pf:f@e8mUK#sT透ۭHuc0gV@ 6jZ}eW9J\RE ]̳VY!3Ȧ w&ju0#;Ȧ½A^=I2O Ё|=}c,u@@2ٱ\w3Zy[G#Kph| *u.s6Y*ٙ.O؝1b.B@ !RGuX&ޗϥ5'g L/ȗuXuHx;N0i@{?w%M:%tfGN^O3]l2OM:LSF{qG쓜xK6lw&5C{c7M-ӕ^aݿ:,:zOL& 2O<:]E3:l*2j7Jf eϩ%:U ȇ.|L@^["Ϙ~5 F endstream endobj 58 0 obj << /Type /XObject /Subtype /Image /Filter [/FlateDecode /DCTDecode] /Width 798 /Height 560 /BitsPerComponent 8 /ColorSpace 16 0 R /SMask 57 0 R /Length 52850 /DecodeParms [null << /Quality 60 >>] >> stream xgXS[/.@zQJ HU %tRTRT!cNB/ " ]W H 7{sO+s1Ư̙&e%95k44Դ\̌ \"b"wnKj*JS}HIU[@\LRS@0313Jݑ|\Ģ N7@LO'j@DJDBJ&' Z:"& Г2S"cԷs1ܯne6+aLAy +->~A!I{20Y*jF&>ag/$4,<"-:!1)9%5-=}~㧚u _wtvu=pxt|rzvO\D?'ELB"?'!)FƠrc"gWJ#a}:­B7 @D8gj|MM6W4[+U٦Q:ql)gm/nx35@)>5r seXܰ' ,AP P%CTg a7j1bUp7]XG7Ums:7oedC0&5.N嘔s =߯V芃Uh[ڎާ˦ ~mTHmU<֊uӦw-p0tHUa՟·lSo NXpх+~u*sj"hLBym1ŧ.WDwXi < _kʹ&fjw -KS3T R^xXvܟpHx4m}H̃l;cO)mh.m@ULֺ2Gw&{UVQk*unt*!&وg٣qvml0"ҭr\;ֱ?G|/$ PzbK[,p7@zkԠo.l# uv!w8@3L4N6Tt Y&+>s ;cxXr8p%-ۋ黢 Q C}KO/([W:mw0BM.C YEpoAZLapW7[fCa2jS]ET+z~W@J0[;ZҏG 5Ti LOΑp:D^?ꭇQN8p.q;gV35<”K4HF}Dµeށ0o~-ï1tE-e-0ElApa's s4[WF$4ӻa[DDCP l H߱ {lk^!E1b 杯֣` ?QJ3~kn}[؎?%VŪ4rCu nӍm,:XKc2Uɯ+V-6 M7v}6Ru[Zb  k~bQn3^=OG~Zě8Lo]CHkIZA&oFK #vj;6H~Gj1Fc9J˞16/vx_o0 W~X1 Vu@?(GX0}yC̄fUqu"Z$>'<o@Lysl:-\s\AW#1I̳79˽ + ?6}yHY#*tηֵ GT|$Y #x>pxx;\ D[JM0lGD,xܨJ =G)B y:[߼ϭ e2ݣt$-[#]t$e<=Pb prS}RUgQxѲREގd Td1ЂN:#:A1 /0 {o9~F 7{=~>de -!&SuǛQ,Bh@.b&~<znrX=u(!bs.n8,RRq-TdXZTeQOi-rbPkeXᗮ#F ]kFfi~Iґv?誠G%YS4>YAd ĥD ΔGR#'OermZr3s D E%P]" Jvpғ{ۺe~_^7/^#JUDBfYJ|ʮǞ#@uP*Cor׉~(kW U<Ss,Oo\jBzF6TlQŌ.ϸф?$l`G K3=U y9x_\GGҏ>PSG02g0| Vߜ\/1siy1d |mVT[q3&ȧG 9i5o;2zFF ڛ,~j 3{x3@rbhV Z u$r1n#uӝK} ʣ>R75KGi%|› {鼈 ;EzM~3A\0 LE``C{AA75IV.Gy麥cNJ\XU)d)>&:A q( H(d'@ 3fPYoښ|[:`6d:xmNzj~ʖA,&CQ2O";2& ud\d(GNs?We!Oi@BI_46(֊A;rJ_-hdQZCsFֳ:*1jd(qNj*F=`KBR%0v7F4alвrA!4Je !\a3CEt pέ 2[cM|M5HFCqQ~^wm| twdP-UO#sӿJ$љoip$hD]ٲީ+ ]3꒺i;ޓTu+vEK|V}~nKg\cw}JHG J_adjIVFTE,I)otE1|,V]]mkT>L@O4'3b=_QBXRxAY4pb1s)Cw1O~Q,L\>]δMFwh+HDՓP+:" GωJ# EzvG9#}s|keOX&.ybi>nOl?q@ j#244DZJ˾oeGh`X< 8My̓uV|W@ \Eߖe > e %q`$NcźʿhohQ8ņn\q 7*ͯb7Gunrw?a OJy`)h@UQ 7f5iO0 0Kf"P[= ntQt.SR?1wQigaXVG$ow(ʊE?NX)!#Mڌ~^&џe/86c7QźƲ  l5:}4I%7e(,Ãc+C1 \8* ey;Q*\4W~憍Crry2jͱ|X1ݿ9~_Ą̢Jqӑ!M42 SOf5<[NDmvxR6XH3lVj{k'`(cS z?*\ECu+@ٌRs˜|y=2=4+H5~X]# ^ޮav&&T, ngD"]on9.7)Q#)68qgRguD\1 Jح UWh0 &rQŁ]V7{swߑE 6f˟߽EE[@Wa7Lk<5/Y+n.Zu:>ĵ^yw)I|RȋBr#&b`4a0Sg]]XO`7nuTr$Pa,>'đ<9-9N}&'jF0$Eq/Xn໅N9(v6_D7[K*b)N<.*|︐4:% ٵ8\ |MFLj-Ncf;=Rl@br#h˄c*Д.J ƲT嗡xV8gPó { zncI轒F})]7d}.C@z$ǿ+ܻ~#脹5ܙX=MAQprj%jE*񗥋L\ Ryu+V][wnIۙwƫ f1|4G2|.YLdK үhlg]b~1<' ]tgغ,{[")2+`];@2)?V}U=v?":_e&&}JŪ5@~Q<밠ӖBbo%ol|1%w;P&*I{mrƼ45s^MgOJkxxxlė@˚>51aR]~h\fdx˒ujFA&x[W@ˌmI@ddv РgX忕!o`UoQҖ \#_"lEEg1B1}(T$[Hy@nj4&P]GIMY S8$ EPfYK;Pg!Jzj( ۀ<5D'[wާHz;Eql. AWR VrôhRgGA 2(H` rw#рj}F|\~!Qx}Ǘ1 9%:zd*MkoW(="$eK'gBB } 8`萨]8]7'g竹@1~iL46p iD=T8]cU|Pa@t%~`?ᜓ3ziC~]NaLzܽڋˍ762#Z55!>,kf|zWS~k)p9=5g`J*K;V)lTpAHTH ?5p|#RfsHcsQ֒|BEj nyDB]68P+i혈 u%Ðؖx>lc)y O]Ut$'X|oOTb.خYS !d"Z"-#| B/#cΐl\"\V2J?}}/?vuwE&+bD Z|uפ8X UL0Ћu_8,mu"2| ͛Re>E6RtF6&"|E+c+Eg6{h4/OA rӄƛ;lVD!5-DH(Б|4O4/ "nO"0rs۳bpHYj7'[m!3n\t<4 Ƞ(&|ZB"˲8sp /B*n!ϯ~&'.C]<4qsF#˥އDY$v^H)s ۡʮTl4@XY&(/SL5-ob[A8>#,̀PXt\| wTRA{n 'Q69\S6!5 !sA'OV̥b!T*qgK1˵uLa/j.kAUTU_QVWZ=3zLtZpgLm!h9GeQ _J`eGgidHNmt~zKNG#exV%ƇJz-^Jۧ#L)6O=3;B*'pIeQs`9kA#CI݆%/ahdy:{bLLEgXW@IibȎt(]UNH 2ݲwщ$w0.`}i&-%C~1='36[p[7_9MWH9kV`D 9ɭ2!(Br | %jH<+!(2ܕj[dH8/٠5VU,͞1̴2O#;%NF+Ih(m @$+1FIA` i..1}0LB ԯ}4 q>!Lb$U0`]ֶ) [fe&*9n?Iʦ(=i Ѐ+>0&P[(<)8K2"D6<%2]V٫J~YVΝhi?.b`r>ԬuY0/l۩ZNWh_o(rR lcȲr㎰6U&o({ :܉HX[owk$ a 6MIHL5Hiɢ0׼Ij خ%HY69SxQ  kdԃFF$C,q2?!{SㇼbeȘOVujApaħJ xFh.|h (C--> TF [HSm7s6 4#mAQЩsn%@/KQTD>utsD!šW@=QW~X Њ{P״ZrizN%7I԰ilCCsʩ+%N^c[Ff#Z͎穻<2r6biѸڍD*5:e lAZz9ɒ'# @,(W.&Uo}f3@Mh K@z!ǗGeg%j@땇 aV\aC= @sMo ӲLjj{EHY@T.Z\2*Cj׻/?4çR\.׉r}-\]}Pd՟gZY$ uiߪփ#Ub $r\ e G(l#5zsV-´էs2ԿYeq" E69оtGLqhpXAq)&ʖ%0+7m桘I7]a/1l JWew!W6yrOc(84;,%` g&#$"|:7b&e lsmg&eI Hm`HRФ`%ԊC(bU~HԠsUԄb6cO7|4W/ fv@̿HP-:.SJKxqMe&JВk'Q]A ,̈́eڤ5tl+E݇%ad2EY[Y뾃R?g[+թ[1tnEʺ6 6ddebH`),?olī0>$IxAȁ{1:*QJ[qha2X &+QbZ2AVtm ``+ T=z O8NBm";E$gO_Oy:}HC(0?cY&r'|>;vv !zAKF=lstq$z ,gsWU S?L s_7tcE _y=O|C}>Ubzh1JpSEB%"_͝겔p5<;M +ӼE [WK]M_nr-28vd" ڋdb h{M_&>*r`ZGWy6&S* cALgWͪE!1wǟftTIx.ZÇ[&W,c 0FB ֹX=1ifG$GINM{JC#/"O >K2B ͑.7b1)aNiũnndc߫ &8_c\u/z;[fn:7{?B*ZN(PfTlK`R/+Ul~ #c?jfB~PM1[lgdo)}b  >?q|'L*5{!c1SIJoo'"x!TT,'EשY,٬0@0;k^F;G? P2?o{$g݂uH (~|P4mP/k$]}bXWsG3G^EsAP5c(:Je=bE]^ur@WR3q&5}Yb2@Fc N&$b" )fW ݲ^7cu 򸩰,-GOi1in O4<`!|Ԥ =c^`jK=7y8Z݇\%\!JEY,m2>@a(d:D]v8[T4;WB9w 6bBq 96 wUz!ŮK 4\#qdEg!E? 1ed鵂 H*m? :38fVp}h7r>ח 'f ATRIp8w]`t<8  KTY A٫Crr}]%=rS2M#+`.= >!BtBƲ6ϩnleA5d!,gr0L@aEU8QԎxjV8!Qt;w.S;~*fY!B["_-&0ق8JXo"Ad$JwLbg[ BF>7E_Oq`GVpɿqƁU㬥ȦcFrEV$9 *V,LIka}!@'xx(_)|p6T?"j:zZ KM`?A>k-M-8@  շ2+aZ~ׅ'&w^Q05f JnLXT Rq^b3?QK `H'hC>K禮+9;2m'Qd\!L(ۡ8s*y(r L'ydc-27C 3滛Uɏ+R#rFGtncMi䲔f4D5,6IpRط"g:lmd%E^51Zs4 * l:H''Mbgn[Uc։Ye2(qywWa-%j˝\EZ d;,zm+ j %*t~zYύ*(Ga[Q0N,OAN:Zi RA}@lb nc;وr\VLx/khTՔH 4rmٗAgf5ɱqяϜxZn?A.M.Ɏp8WDӾ"=`Έ}vxk sOq~cD湺WWRl75eKNzW}v/se=vf(җ{EyE?o?3uʾ}`rt/ k@L`ef>{Y#};v?Ӱ\Q'$\\XW,"x䂳qfS4G$2y_b_:*q(`oMS|e6J_}$6`>.cOG=-ìm8s͆4i"([s 3򼑽 ;2n-gL?(eK=+5K0BFe8s̉։ Ǥ33fi9bZXET(c!Ù(R@RMbP*e,fQ(^4 -nL-8ف&TOĆ.!3hI󖞒ndbI@b(b80H ,,E5\-YX Ahekꮺwo/ YI[A' vY[8bdl!?'mno/IqgNbt5[0 9LR I`1CAJ Hkf$J; phD|4b,5 \"Ye,%|;d3Z+9!:qK\(q~?2]48vAJNQtcyWRr/Ԫt M͘q[O\r2JEL%.97`(:ՠ8qzݐ#MO XkʇbN{{kSܝ*$uUo6\OAfahߓJ1)Bc“T4lF>j@xr'ɯG:=7#/;gQ4}KiStn=~ > Qt lbp@de!~4"%֍ A&U>Y`#GR1d2P1W$4LPm=` 8`mA2X,UPK5SӼlj!7$"*"FXHcb$5<0 7s;Ӽa' PQ Vhd ,/'bI\ik)n]+q bEj{P e#, }PiuSAwBĉG RU|U6|,sJCwNZɏ:tYW@( Xp䴫Q  īp[z4հ9hs97/7)!naaeXc͔F,44& ֡@Ͻ[ŗ' ' ۮg}(]O%Sb9DrmL~ pmO eabj`=1y?DGG:`%ƁAP! *Y )a CMLîB(ke6C5-Eh@)@e+7G6B6b3o%ecuQdK2ET4bJ: Rq42L!Au(6:_38CRvY@J&Gb}rSv8&6QՖp S;M h4,#d(]r\XMհbY6ŦoNw}˾zMm06oPA>9/7SVW] lO<4h|Y+p?PU**eMhhK{% e+FҹlI#N5482EBs<ʧ-+).fgT$ZrzE=deTa) x:sc- #Kgg" ?4L .Eْ((J-wUC 6CΠ{cOH/F~x&"Tb2秅v~  C" Tf/[=iO{D#&S"C*]~Жl$p:agඵu>Dg.w2q*ޗT)1q̳5kFqWQ(xyA8!8U7ٯ.ܡ PٶKҒ .RZG 5gLQ?Yu(s -5 N- }Nzn4> \` puƚ|L7W֞׌o<2-ߠ.|`)]YFof:+kдH!?4boꬴ;訌[{=G[(73\Ԓ*틜+cϜ{KI"M*GpwXĕaц5_FLvY "*>2Jo>,6Sh {+OsCCdͭ,tƾ̊ d`0LHF.,#s-3No {֍{,q@筤2`FF/5hދv*Znt=ڪ%bF꤯p$nGX$P;BD˱mOc`F|ݖ CpT) Ԫk h͐B ~Aa=EW@h*9CF~L4U$@ݚD|ІlW+Pvd$9gRS$>F2 G1Ѳh2l t+GnhSzg$g߀(a3[pnv&7|/󎴫 =x?F D c6?R?q$\V &[z3粖_d7g P]GwWތKp~*m[e>cjT$9@\focԌrȈ{҈S̖|n!M?ٚl }b='t7E\=أ;ât/r 1$@mT\`RPf}7I|g ' xĔ@-<(WyhK 88d""r ֌-pG)]:ӆ65} K$*s-NC"}hMun20'C:VYS1嶥\?aH%ua,n AbJjUwx7ZL4kM&rkt@Pw~A6-IoiOY\le «sh;p[c0K-=ؗy) mMAxO;}o_oͣ$+U9C*rǞC /;M>.8螤B,{jX[K o)bmc?=QqE>Ѿj~H}էI*XA:0QpY\>3Yr1]/Ur1Zd5Tsg{bcѯyc`"+ 1 b-R{ǽG*%NޖܚOo7,}ʣ5q9~}3T7[wwlkhXg;]H@J0h߿~5@W8yL/X4>u] C,YZ*nrǀWV@HKGp= ц=-Ѵgg}f]wŅu .mM^J$vrEQRѠKZ26X3ũZ%~jפ?3xM y&aRVtcp>xTn,^꩖y0#vǽ܋us6hRCǪN5W@me8W92'~N79mŠ/ƤMN ،:BZ2a/L)rꪘG:bgKGwMoExI,gN9T;C$p6*LAg]В6\6>5\ <1׸,BF C|)yB *#<*?˹1iaodh5W^X gj8.ff6w[%7PdF/ {/%3O.:IQ"ci-o4mh{E\g p7?4(0 (S0ڴAG`a~&=Y#(XM_l4[䍷;ƿ|TLk/F:|m9c}AV,t5\//'+-{%N,Ƴ~Ai,2NϓOG>} ;l% 8k/RZE!kSБnٸ_y$VR0Lu2v,c!NFl^Iatilr6~)T%*k3 Ef.uV!#j<,3!G\,}Rk]άE.$~O$dWjrAcZC:ngfeWITJzuH6GgȮ_xc/({5_1sk-"y1f0Tp2찤=K\Lbe>ׂ64'L@(g U4p{Lׇsܦe:mCkP3=WpMJe pqT ۚ><|}06/Lwy!n81FGAvLŷ:lI0/,eW/ݸMv-̡PFz ,p0ȷ̏Oz^!ǗŘ̿,Glb"^-|^*>+d'0L\ɷ<2|6jߒw<ˇΠUeb_[=ȣO>2<z -g]{Z^yH`9?}L0cm> :&І]nf49Vͬ?/Y$ &JƲ޾~iA_2 u+VSjt7g~hӤdiȫS@zp`[$e:t(,QxPeI\0 Y8cMW dE8xiv.֞8Bz-yB̪4ǔEӧ8bWAH`$sfZI㐕4+,sK|W5!&ŪgIuigOʻ3zQ@N4, .J'fGugاOquQQeSJD7OX̹\vX%".eV1$_bIT94лKZz$t\!3~ާ6_~@ MɂO$7gA&WP>}WŦw9Ҏ+І7SdElI=1tF2 y_K[QwiZ JRURe= '=oPP^_Jg=6}.kW@}󯑾̦e+,~TR a\a &2ݚ./ Ѻ>-]Y茿+6eԎe2t'"{P'7br8=K$h}MkP;%ׯyS4Y!<1#_:4Q`Zܖ}^Y6ͥ+j,<|b4\cqx|T=m$xFD5__?X9O]`>G\.I=L5S})a=(pr8Zv_"}tH0۷l}&o~  -cGdv緀W'M4<j#4/b3MǪd>\F {_c7[*اŏP|4$ya|TsgjR)/' =؉N?4R}}ٓ?IS7 Fz yLɾ`$GT%{÷bFNbBmD9̜h;^ݡ*JMST5/n]3|-INPC7FѧGvLV8d8jsU$~qS2Y& ,`(Fгeގn /ϑSȥN۸>'.^A-3Cc SǨB큵CCe {Fsj] pY{Q۴.WKX /&M42wx7!Ʃ0hvC b1+RHyoVF;r-a$K R}_kEj=9k;%Vow /3"hu^Q)Χ?iܿ5V ddJۛGu>|ڕh!%s]nJN /]K:vvJ#hY1sTέhiƨjaN\YCT),p񚽧wAȚh_ov4[A8ͪWj^@|<^#}<Dj-.{9'@}rWL.e/G<^lt(ۡu)d1lT0s`S@#I]C䟨S_4O[u Bc#v)6QN#z1p!Nw],4=J J 7%sW(̈~>30Y(:72wҴr~> DVy{=`Dө5=~{{nOBڌN ;xS.鋛?l'+M-iKI|Oܠ'.v*,NPfF#16ue[6ne\ '7nX$Ï1,ߊɚGRjx!\$arUMG*@QO;mBUWKԜ5&٣tsÏ6K6%A3weM\]mڜwJ^i{W"R|M}:ubׂ%{WTغoL`.w;0EHepK=f"nII|L]!L$X(vN`1ky])M\$04q>LK1|DSs^Jv $x.kTI$oǿD$UMf_©IX)#,/gKݧNt:Tk ` *3K1Ĝ% nzLݩdQ:=uZч,-BQ?:UioQM!̺ l.XAHs*t϶lLC ^S:Qm]}iM%SJ+B GW<ͱ؝CՇ}Fhw"Gh5UUH_TSiCrMs?N)ⳎÈObzLWδ=]mbŅ"4فoߛ*bw,WKtfgf)rGrT.keݯ%2ܘ~ܤиmSeԗ'H\ K3`:a}=%pp{Ycl7YmKF_ldqI{i+pcd5taz'W^]̕hYr~Pt䵘 "sY4s_/A#TYY@ge5k6 xBrEVTƎ þ_i;*mu(gblxq҇QGn_]4:c'N?NQcyoucdU˵z€'X0iL*o2wǸe٣ {vdub4%Ĥ.t`uuM 7QoA{Zn֩Q̌ \G K1݇FeYIG¿GS&oFUQ-Hl#o# xE&<0=]C+{P;X蟫kp!MǍ*=nβ[RsZd\gGpbGϺiyc+ /zǠ逛eMmo/V?U9fn~}7%(;֋F>?7>o6o ?kWm~#]v4gvaiuw{(:2׺W*.E7+Ö,$F ĹXȁG/7ik% )v^?X`5[A!_@/EHe׊,]}݆A>iμ]^ IlewsK>(,BKkH4hl`oРu{(óWpB; K:a2nGE}Ih߬b/oW@eֻر]VSnN"*zhK۸3ӕls| [d l>k/If}sN}W'AkRgn& ڙ Bi$ MbfH׺`|Yzɓj>Ef53ܩn-1v'6>̲dۑn<: -߁=zѽWr q~ _)ڸ: ` nV)S(:Sڗvl/x$ Duh؋Ĭ+V2c:eUZBڭrVv#ldȿ '\t\b%%tLbs /~ O|%4`ibQo[0͞3=ꕯ*{'KDZ}aW h&D!g5.hI}3۝ͨXh oBww+u3Ƒ뽖SFq̘{hRau#O?";,D]ثJ{-fLI2jehJw@[`yBFF|j~b"5U dto=CRg /WkyeڱV'W8s/vbn?r"ߩ8N*YjYHb+0MjZ3Ș2^_H͉& FDUQΝ#,{՗1=ݳUvaڹb}?kzTdsqyN[Σn7Q/+qtcmF9P~рx5l$nL)Q i;#p(egSaXkgt>ӊQ)k/Mf0АHDذQ-uW+ZY)5LwhVbbÜ(_wv l*WEz o'=:,YkyM ɟ`53)Y ޵ ;K^d h}bj-.>t4eMʴva 8<+sW:gYoMRbg s3KAoM6rY(=-^$?Ɠʎ~8m›qTkLo52Z$1wNʗGN+Z1恣W|=V5y=ID1w%)B}D̲'N)ӹ og}=G^<~k@+9lP2Ho(խl~1&=)kӰ9|yPj2'-$k6_~;FA_$Cb/*'b?RX@>*NծK=26H'i/uͽLuzmK ,gvz7m4~*c{]Mxdʻ^EUᕴ&8U}Jlx)9^YG/tM޶FV"ӮiG김W7 7ġ1uJZ.\찵Vch㵘떅VZml;^,! ֙6V 2N{B e14<4pG*F$ߨ|Ԟx|m<|QXٔ^,%I?4qb~vY6)k-\Lq$1H(P-H4mҋ/bQ 2^h5xds-S,?j-jll^Nie~zu97TMq h)x{g5%(+8۱ʵ㜴gOU_`zY6Lowm~ ײ ^ɪ-?\v1)V͐\, #?c!~ҘZ=֭MTK孆 49.V{))!EOA~CBk$օQLMf?T q~\n"pk jr/>fL{׆EGn٦pSUk2oJd!9KW0!F[Kھkd-XO&?~(Et(Vbluqԟx*/8GK{N^s}8mBV.n٬,ybff`rLk[r*? 2<6y!Varw`&H՛%$;ceڍG*5)eEQNttGI+D0f5u6Yv G)^ivR?=TQDj^E3.K>!nMw=;~ %=ќ yvذ#u iqnv+xtGxx^qKZ8)alxauUdžP߉T0Tgȍ'kSag.3GׂfC8XY:kq vf~ vA3Ir/BsqC[N?X;Dy$޳TE@Oe苵N2KWos_.48) )9}gkN*c;. xbNƖHL~8b_nH״ S<\dq`t^eg; 0 Y*6lsWyd ޜhG`lٍr1+4)A*=aKQMſԈb&h1`СՀpxgl_(}*aC@+2Eo!3clr.K`v55 "*QTR7(߽~9qD*"+Sx#;;|h3t'{%ķKjϙZJA}tpRb(?=5qyޜ[3Fl#f`?Qզr8tR`/Nqm(''=-"ldhǀI,-5xd{h7Yfkn5fnw";#4B}neuCFZ*MQ<[ynSN ~J/:w+n_'UqBC .B%łUdI &hz-8|8SA ۼQ\D!~{~9UKޠe#ItZ}$Y.`~,{6Aww~U7KWS(=-<*[ou k,]ov52g^cj?pP aj׫Q1?܅JJZqb 479װ܏7VK!$;b' p|ֆVm9EЀ9€(8>eE|L/|n`L6`>MRM9(Uͭ#EJHFK_^|rijf㫽8'1 |_=r]pRkr^JisvSE]v><[1жl KN!yCn2.~YTj _D=sse:ֽZ5LOvoO$ b #2* F1*}_NLnvrWQ5 ϻMM8԰q{D^ yxCr\BwȢCgGfٳFۏE~3+@)et_#NJ-_DmeJ;ߕOY]?y$T'uJBbҒج?|xE[2]n5h'V~'B\1ļ#4^#/~"\mr%腔"Fn֭mLA܋GM 89E [(&Ȱ;˛zxS*D:DC m3fkƺ_q6M쬤T' j(XK|#>xm.\6Ux(G*m!JY&n< 9rm+LAas7<]17Us9D#x.q:`{S&GVjխ]n1d5 5J4:Ix'N>-mv NSo,mSP$@0TŚ`2 1>=LLr;6ا-.ܕ{{Tw/ҵho |Otڅ"T~u[WX?v`ݤ<^sQdMd7\Ǡl4V,w rlEa6-Mŗw5ܺ{[%q1o|Fbz]Q,w/nK!ۯ7u}Xቕi{; ޒnY X".Kw2k+C. Xy$GES?ɿ݉:" C+A-0^dt^۵_xXK-%p6^Sc&GK^v_htaBei(Yt9Q/qK,z9YR="ea{5 &k@{ rLe IS )w ,t˭s 5Pf@=9Ug_)uM](WwK3>}Am;4ILdqatTt ?/n\?),ЩiH{\vA'=+X=)pW3S[,#e^4_-W[lsFš^Pb|=5qyG9_vƶ|hd{jd9s[4_NKC*^sy=S/X~,ݺwWƽ"]w5W=“zes %R[?~},obUdt9'KǭO)X]5ʆ~K\.eID߀~ʏ*Â캅*5JT kשOdFowuO̥ds$NwFS@Aas6xڬMnJ ׷ j&_hWTq#Xu\Zit~FnZS@w; R]܅jK@rъ7Xfh?Myi=S~3Wq1{.WTZ1L-boinWLG )Y4gz68kmd0C=KMHnLE5^A;O5} St ~ͅr'ЧmwY[$[g`z過\eql%0BdoI8Sm)f5G@D74kG`~#i?Ų,iyjޭ1W^ᶌQ*+l!\ T׬#hd#M}8|qc$]nG*6b^i9S7Ƴƛ vP&9S(u =}nί4(8:EĊYH#jZap{H4M:Yh|UuGTBw O4՟+oGvr w$.>;f9%Ez L{WAlZܽx򎙟޻ qH5*ƺ>0>u \O)5*X\J@{ +vmZ*1:{KBfʃJ*9|5<[\y:{@ºYU[?__hkZEwP>VrκeFS_6׃2[:G49uuVPbp3-[*5%.d޽,_=g`U6M*pcuѯ Z-׊~A*i v5Òlg~]|u[ǭr2`vZ,\%^~{@Μ JL G*#.{D~D.&}syiZ~]%)ipM{;d<mԸXfF@ΥnM% ǂGF۠Aiiϰ7d; ޮݿt7f k(9;Ⱦ ^FUl$a׶p߿5QPI;͢wS;Dx tzTۦ#&Q^)&o¶zm3mŠJx)veY2U\W;'Dcܲew1\|+U!^Q]Aݳ&:,;gjR=#uC59s}wۇ%GLz$@[8bv6gYGY/KR.1wѰ3} +OW &KvڌJNrO$VL5? L _LnU-rZv)wEEep;/M/9`Uux 7*;k#&&`4BnU} 1!io~bÿp55yY9+_L];0r}\]cj~p)R(V\ Z܋KZ@wwZ!)^X}?ٙ;w:wv]Uu nz5 &'ܡ٩aS)Е›ڞxh8*gB͝I>{Br 1_U;s-YO"0T;L`J)2EH As1B$F)l1i:T}=)@hs&2 P=^DJTJl-opjO@mE)wτxߣdf%uq{Oa"4#z?/= b |x9ߪn_o6M-LGU{6|үS๤%pu}, ޟ'ơ:y,jLv|xcTY̕ζ8 #[*oR>˜<\2@{3X*K9 %7Kc"4s`i^? kc~_`]׉%;HQF,1F1`x3 }GJlɾ`xH- c"-dLeDVVZBSBCv97Q;HKBe7*\fT升up]a`ZTG":;՚c۴{7Zmr9$~ȏuʚōC<3>doV$} SY R{MV-"S&,P~_+>W +O~WK|/α旃W1bU*i6%̹daʟz9 e߻Tpsԋ}.wV< j>!b.TC]#FAH_$a}c J|*Ew,Uȱ|Y}jKUZ?;v5Ab|y$bqQ';R~*D.bcl`S4L݈'BHYjqyPN g!VrP1~&4Uoo+g]; b93酫y EiV|Fʒ;ܒ#cy0XvZAA%K+Q=6gS4("9\{t?^蟎*ڟEhnu Z4\H1|"ČAk\Փ)ʛ9WP_2χ5(oEf ޻<~B|2 vz-I*0-;<>mQM`Wd7;eo{__i! ɏoPP>J ^^UǁP*䳄-OC43^w)zR-ɴ` *ii}с\$ KAs{ug׋Bk˅ߥQjuu,2T 9}7`%3İ]ɦŽEe@YF)xV&l9EW'A3ڞS;./a^ ?oq}r3`mIP:Fj}+@hne;?^739Kxǿs nSWs(ဥ=J̙]Xd<$u^VXԲ:[ĹhgQ6=>djEŽ~BV`锅~yZ|wܢ۲2X+;k}x8zkD7| ;I^~O36QruZnۊn$;;՚ea[vq]wwXi?F]H:M>_ORL0|ۄPx2-lWǜ`|Xʦ KazBOg?6j/0%604{ڢ1[}* WlmS< zo0%Rbm^jy0Y 2`u^}b h΀3`g1B5%ir,-i1^bЛegTsjV `rVF(uk{$uMbSՋO%*{fa!6y$?&(&4VMJA0[dM3/*n=& GzAMV }5j '\c̹XB]Lo:>>\j_%3WUwd!;^*< '(1dH+:k`'LN@>-%? I/KMsT<-\_;,BȝWDInDd2kOE2}ɸ>PQ`q$[$@hq\a߅J`ٲ:J.O^VZa@0J!I@ ,YTX wOvΥjRk՞MA;K[@807T5oKI07]Ra])O E.m^ي0l=G/u1<0gn\yTLtUկΜi7|DuoN+($:83y`|$>ڥh΀;qk\b+%k: ~Ji/!?X lZ0Xy!j' B7&_)OxoPEՂwevƇ0ϵ0K<8C㫿^%8nQJm_ƜT) ڏc-b 5{A[側8s}u"ʕyCZW̏W_8qw=1=PϓP=ڧdY,~gjӄz-?a\bMVd)GW_ܚq?}*3 21aQŕjI;4]i-9i0˲\?IhONv H +P~Ux1SMtðK橂tց=O$]H:|ȵd_r饄 ~"k:AK? SyI (Ng(b2MYmٶ>ʴϺ 7BH-'cz6]j*;q6t"DT@bRL Ax ^T B,#hn*eMh(@'歰di%_ۮgNYӪ7--17R2W9Cdvb{xBq J*-Ŏ-k]Pb8/,:MT0L#rv0 gff& ӻ֊ v1ou  _OXɚ Ås7.K_5N"9{~Jp 7WkqeSjƯ4eG^m8j [ɻNTͨTdOg@ :IDGt6P; N^)'OFjt5jb'7ą+X}>/w>->^U"hNLQdp5a,RLj#"w+KxMp-dJnh +*hPS25>nJ?PbHHB,"GgυAp6)Q2g]dpUM|efe6J9K7 .M+LWh9c- $͙3uҐ%6/NK1"R4v daw| fȬ1oU|Iԕ/U^ 5Db-`|ӐgZ@P1gD.@a#]W8+ t7ENLƧy*'1y>EƏHTAƩw< 9/^\~z +}g~ζם|g=%.toW9'K*y}J=`1?e`zsL󊣾E5 SLMEqy #(*^>#f @riVKhĄ8b4Y3o}c.'Oxf.~uD(?$suoSSԙs7%OTJ_ܔ܋AQ%džq'뭉0/yo[mV=97'+?d4[ NAnaNࢳsLcF/z)Uk:q&J.ȡa@F2݆p<u11 ;WgJc`lPyupcc>BEźTOdʋ5 SĮHms-01UI۵Or+eDžJZp0@y&qa6b3jy  ˆXzNELYFD'% ^wTmuͤ tV d*Az3\Z!xBpbl"GS>X O, 2;QL|ˑh#5 {}Ia-6s2T:zC?F&9@A$&6:V;YORsbW(%VF4Ыb_E VA@MI42TWxN!VnUve_0?>QYV jߍ I J@*"b De* \ϺgZМAנ?I&B=!ߑ%؀JK,eRT徦v@lB)\bw pVƭ8sǗMG"6I/W~w@.*3ll`W%30,¬MD91ۘȆqv/8\5 N~'nD߀ qSZ..<^LjF^W`@͟]"M .tyĠM \[n b YJ|y6{ɚHFߏ_}͘0>'d;eeXAd#1@I]~A$㞔sPR*NtO2[KcncҝI׬𒞹00CaŚSv5˛{<y_f94|7rTN2RðiBy$[C5@ &Yu)jzOeFJnAe^h?#p$X"$_M6+2PO]ch6g_ TBawDxo;(co&oFSb<m~wY!6 ].q_Ey/Fx++_ED;M[%*I9V83."-03UROcz_"(&o6VSsBùTC(@*ZJF)c{9 /ɿ6V`Jrޫqtv7 N`aJt:9hp9 ]bM7?][.]Ɩpq=^gy“l2ЦỦ!g4BɊAɹjc#W6 CháqYBѝ[nfi(d5mӧsA4ALoE?~ wDbsPP@'Ff(S ɪj|ko`':XvJT|x]lD}]Ғ IfR"lpLOpcV*fɺ Rl4ͤE|:4: #O RƦ(oHoLRQ [+^uֳߨ[$[q4whN4lα ?Xl6YC7iɴ`İm̘IU+@3$J>$Ka{lRҊzDZm=UXQۑ.ԥqgFXsTQǽ9#j/+Wu̱/I|[!om3 猚3%S2s%41ʜw HnWyyL=(B>_JϢ) 2 gs5*l=Ty20a̡>,"*10nT ݘD-& GyjǹH9JՆps%EV΅ya 2F' .bWnő)srWRK봞m" ŋ\T紺*jaB/8$FWiBO/WPܟj풥?C5%D*d32Ry`P_; KOȾ: OE{Ɩ\ lF7yA ފ%`ψS̚{_ D"&iƍ7%C~@? 9sl;JT74*s&aO0 g8\?v8gS{16kwJ셊>Zi{}9H+gtrD]e{N*#sOzQމqX#RT$>6Z~Ɠ }}`t?ϕjim3fB JGnnF Mb.T_l"5_`q%yhvF͊rzX|e{DZz C ;pRyϨ:9lkNg3I8*C-@e EݗJ'9/92'f ۆ(84q-fTyJ`Y_瀤OofA("c wj÷B|$c,)Ƿg qhC2R,J.p|Uf* [Wb%mg2j_ dKjYldԳ-p%` =Q`PnDD@g܋2^>..mMԎeIb^V Ɍ5Jv~^Ih,!HeJ{WQ^Y\~dB~&*ZR1v},;MDȠd\Oj\92TR*s}7vDЉwSmDVXCT8y"-3M* A"7Slq+ ; 6d(|C?e);UODC߰HlfHl$W9-Qhs!<\ʬgf=Uh,},o) H"PN˽gyíC.ƍV^H^@!=BE^٧ H:Kt:t7>xI4tݧO\@ˊͳp<\5wMF02UQFN>gx~==Juٝ#qUձjb Z!GlRa%dɫ5 QKym MX08a ke[eB/){#Di(|wJzqJn}faO;́_J,T\~nž)qWRר%icpvCDSg)RꈱXME\cq*z_~P? ?CL\%ikәpݧ솮pAW=+^EKB}Ѕ@[˄}뗏&Yq`Uԋ(1dLlH+)]an8ZbHb1gxCc b-R9)+I(/[x*|.J<\=(]]Nm/>6KΪ (hU|Q*p/}&+~HD_O`:.ƩFEA\G,W9vgldlP#yN4_vnT/c :H/U*q 'TJ>E4M w> efA?R&)R))b>J*$UL=_6'&_'a69B 7xNu>; Ne`L[0PӣBs ZЏS Q k4_Pb%&k ܒ *`?).@/9{'1KgJGlk6l|Ms [6|6_vR )ߜ8&SSw2Ț.ܟѡRM}ثQf+q8Jwjdr(u[RLºBWN.l`["#4HZ=TN1a*BYKZ*BP[ LϜ#qhc!U95YXXmT[2GW', I:?KIg+iw;YTbgM/EYY::nDw _zb]*K)[\e"F̥ͅΗq(t`VLpiN (ItTD?B跲-%_oj~5% BuT_gs|9ao >bF%7f`yI.e|P|t^>S*F[aZ4=}WeOuVa_RwYgŤaJ"jO-GJ>8XqJD +*Z|k6쓒l]'ShF!Rwfկ g-#_yjf/_PsU]ۅ;xέ& Q]+.!rzGޞ^xS0xc;S1=qLd'犗Q^ϕ{E^i?y5\6愎X<0T£Or>tE.YMFF'Fèt3iT\gA^ɖ]@r'k54: RSZyV"'ǣ_;V煮gìGgWyZ\Uwaue?TӬ~d?X`wr;2-pM./Г7inV@B'Sb)Ȋ 低9%*`8-y J+[\UkL:H G ׷nT0nFԖda}xGw'7L8As$Q;ƪ~/K-::G~._TωDm}so8Ŗk?,|'v UM$'qLkcLY4JOX/=#t| Iu@7L#Yh%: p69wJx 5uȓ-K dD2Ny\ )b.Ь>5,a JU]Ո$.?1/R1 v}NJ ^1TNYIYǵbﲖqO.l҃ 1 W8K6Wz=d*4(u T7!ܺqSFQ3N Hp3L+,V(i5S`$u%THgIDm v2G4+sUG ,F,G!s&=2 uF1ng̿lNaI1'Xw P/| {W$S%ƀ=0>|8lY?z|| ^+^*b Xc.Dۆ &{RH Ù`I:Ob=~'ԧȵ3OT?rS '$5dLoԃԎQօHFaoM0x4Z[YaKdy? MVb7zGGZ_ʮdgie=~?s[mGN_S/>@ODu/ ^E,V#jv߮+ró<37.ʨ#>`K2J_&Tr-OM>9)w9c5=QPav  -ӧs7l?n^Vl#H25:/_ff޼߽ 4>`O B/Ę ZmlQN;xk*VfGH+U5e&_AuI6 C 0V~K~pSm glДT#7R\%smw%#$ZmկLiIǍOP*CIVsC1",ka푧O\`n=8νuK^)fBkNp@.O{,"Ld^}fX7@&ܬG7[yJѦqXMȴ2ʦMzF# 1yr]d{po?Iwqv3;*\Pݦj1#sոE>OC$Nuðy+=>[OG$ 6׻(-K %HGh:a::5瘈G//$x !4px~Oj{HӬ 7~ /zR(,pO9tLGLJBzhz˼YH&*n"'c b890{( "-,&`Yqd>?BQdme÷RҾ)Hq Rwl$z+م),5sӗ+aD[t.cFKTCoT}#OįքL6&4fԬ"qT~,r MH(b3czdK[,65n={>O}EIn(mǦ sVu1A':zIaMu4s)=s,1q ܧs )9^;p#=:/En؅ 0j~Vz^$!^Y'Jbj\ܺO8(buc_*)%L_4J")&p!\=ݝ~)r_Y'eb:`S,:`w~[DHEA ]T,\sß52i,b#>S[BOEC@C?8,2@"}Lgk?SǧR݃ yZQgŁA3SԌJVD r+>p/C?las2:Qd"U$aoiK2 :\Psʒ[jnߡt:]mH])a$t!/t] &;yA}^,B<$ CƘNX#29bJ"#[@T]?jX0p8KD'hfBd)B G)DqD\Mv|m*qlT6g#bg_?rnZ[6. 4O92j1igNlp1I}׊X&- Cߓd`J*+{oWzǏXmօx60xr'jJ^Ϥ}ָ>L .|OIz#U_~ {uTȗW5Р3ЇJi+Ӟ<뺸RL (JfSVQr{y+N/$9J|>T߭X?W&9/O?WĤUڕ/%/y{t[X;|pj÷D%1?Gw.ھE*g]51)m6tZa`<;j]vW~w1 VI>N ((T#gl5x& ) ?^;06u :Q'%2^qjqTWqTJS<]OިE-W?FIGvwmTv?7e@_pS塿O;ߥ1iF>6}b9Z208b=|nA W]8G)Xdm~60f|*OK"JRDMokKo^,֜/ L:cCob3ztKϥB#z=a,v 57|fO8PkUIGKTӀj'8LF9/3ynx5]9j2V>%z&S=@jC65C ~ZUzSy2&Tlԉ~)JnS09 %m3g +obddBp4Ձ=X1Co?|Ih_{kon7y.Xέ(:4ꅓ:bE㞚BZI*uE^Ҕ̋%*I3'XGFp@ߞ^\hOZyHNppTgrDp |e4 sfW`a01% wg=xu|-F±PۍʶaD˟Ǥ35HU}j\Z-Zsp2M2N}^+-%i?bT8,\/Ľ#n^G\O۲#N[AU٪SwcϺu3[s[4* ګ> !{UR4c+&+!\ I?Q\2!kV&/3zY*YH;N0eNY%4ig;/ R:䢙vrs$3̧Z')6peiEErefMfxWǎz 3JlԶ߇ @Η:ˊrfߗa̜tƺ 䣞}S6i*[< ٫~?fKe N4~S!'ƽcWĖ5b/H29بn xfpg2&rH('ʦ2frF +%OSh[)qI"KPGvSE{ ^o]r#@(=IR%[ xe|-,. X"SPͺlu8yJmg+ys?ڎR_`~zUT?VD.u=RV<1ɜZr{}=vK9\JH=Xӣ{X GC`䎲àj D' y*1U/k'U[߱knsbI湲`D8?Ǧ6L 4Vh<=D ¡ VYibp'm+[Gzw?BV'ġB!SӼR\p<1w~@Cw3˯LڜK4ĝk3ϝJk-V{F'm:TX3we;Em_e6TZ"_e$*9R2l[$R̼ipzR:-9ԛ#-.˵I5LY"_ g?C> y mȭD<:1>O%76_Ҽv]?3PżT2ZxCف~6e q$}&+/LxT56k@8~rjƬǚ'-UWlPׯyEMON㭊 R֣(t,l܀ui߆NGU['LnG%mw^`T 2xSCi2SwUS~=n^%]e`@ fvmXOe[}@ w-hۀWɐgRq Qrx8o%}ZFy?L &fm_\Nrs8SR;{F2OK0s|ف[9W-$P|ғ'e,md[A ꥔=3jXBDhu)Rަo[rHkF'1.*ĭx8x4 V<(rc)|)iFu҈РXk+ˍ*+ygYCM?/=># [(n@N Tuҹ?a4wyY @ =|g.y/K U#dpJ)p8ēWXAhgؙ/XF,6Bj70Zbtғ,x t_1Za3^g.ӽL7r ,E o.e9x)(+WFF9߬4X9n|g;gK[/џjZ` 9"Kfϰ##; y1ӹuxC$B7(?Xԝt$4ɵJtp];Ep\k u09B &<"p,+(l]4=ذ*o/f10t4DH '< @/(1:|4~}Gq;=kַklj3ӉKuƩh^p潂G^N˻7T=3ȱW.E*W=6) ^A95-etv]h)ΨW!6u*y+T8JhuH ҝV(K mQڞLj8aXJ:T}]('N0UG SUb)O._ƹJf WuPYɶ~h` jq{JXoB 1Uo{ƘG(fB9JKj mS`f&9y@捝C~ n0]6@:oq}9-x+0Z]o'# MSBy@EspA!Kyv@OB$c_~2]ѣ [3}weMN"!/gӼwmyQm)/91Gт2F~q$ :1|0o;fj!F_zq7omLR+.+.J1@d74A;!q>>&ُ)NEV{WfaܳK^v8 n@~w3̰֩jR"Qs`wNX] endobj 61 0 obj << /Type /XObject /Subtype /Image /Name /Im12 /Width 143 /Height 305 /BitsPerComponent 8 /ColorSpace /DeviceGray /Decode [0 1] /Length 43615 >> stream  $%&&&%!"%'''((((((((%"#$%(((()()))********%&))))*)***+*++++++,,,,,,  !&*****+++++,,,,,,,,---,------. !"$(++++,,,,,,,,,,-----......././//0/00#%&(,------------.....///////0000000001111222! $'()-...../////////////0000000000011011112223333334' %()*.././///000000000000111222223322333333444444444445555. !#(-/0000000001111111122222333344445544455555555666666677777875 !%&*.00001111222223333344444444445555555555556666777778888889999999:9"#&(*/00111122222333334444555555555666667777877778888998999999:::::;:::;;;;<'%(*+0222223333444444445555666666666777778889999999999:::::::::;;;;;<<<<<<=======>,%)*,/12233444444455566666666777888989888999::::::::::::;;;<<<<<=<=====>==>>=>>??????@?@2 ' #'.1222333445555555566777877889999999999:::;;;;<<<<<=<<<=====>=>>>>>>??????@@@@@@AA@AAAABBB7!$'.012233344445555666767788899999:::;;;;;<<<<<<<==========>>>????@??@@@@@@AAAAAABABBBBBCCCDCDDDDD=!$&,/001223344455556677888889999::::;;;<<<======>==>>>>>???@???@@@@AAAAAAAABBBBBBCCCCCDDDDDDEEEEEEEFFFFFC"%&*-../0011234455556677888999999:::;;;;<=====>>>>>???????@@@@AAAAAAABBBBBBCCCCDDDDDDDDEEEEEEEFFGGGGGGGHGHHHII? #$'+,,--./001123445566778899999::::;;<<<===>>>???@@@A@AAAAAAABBBCBCCCCCCCDDDEDEEEEEEEFFFFGFGGGGGHHHHIIIIIIJJJJJJKKK7 ""$()**+,,-.//012233455678889999::;;;<<<====>>??@@@@AAABBBBBBBCCCCDDDDEEEEEEEFFFFGGFGGGGHGHGHHHIIIIIJJJJJJJKKKKLLLLMMMMMM< "%&&'(()++,,-./01122345567889999::;;<<====>????@@AABBBBBCDDDDEEEEEEEEFFFGGGGGGHHHHHHHHHIIIIIIIJJJJJJJKKKKKKLLMMMMMNNNNNNNNOOPB !#$$%&&'())*,,,-./0012334557789999:;<<=====>??@@AAAABBCCDDDDEEEFFFFFGGGHHHHIIIIIIIJIJJJJJJKKKLKKLKKLLLLLMMMMMMNNNNNNOPPPPQQQQQQQRRG !"#$$%&&'(()*+,,-./011234456788999:;;<==>>>??@@AABBBCCDDEEEFFFFGHHHHHIIIIIIJJJKKKKKKLLLMMMLMMMMMMMNNNNNNNOOOOOOOPPQPQQQQQRRRRSSSSTTTTL!"##$%&&'(()*+,,-./01223456678899:;<<==>??@@AAABBCDDDEEEEFFGGHIIIIJJJJKKKKLLLMMMMMMNMNNNNNNOOOPOOOPPPPPPQQQQQQQRRRRRRRSSSSTTTTTUUUVVVVWR"#$$%&''()**,,-./0122345677899:;<===>?@@AAABBCDEEEEEFGGHHHIIJJJJKLLLLMMMMMNONNNNOOPPPQQPPQQQQQRQRRRRRRRSSSSSSTTTTUUUUUUUUUVVVWWWWXXXXXXW$$%&&'()*++,,.//12234557789:;;<==>??@AABBCDDEEFFGGHHIIIJJKKLLMMMMNNNNNOOOPPPQQQQQRRRRRRSSSSSSSTTTTUUUUUUUUUVVVVVVWVWWWWXXXYYYYYYYZZZZZ[L$%&'(()*+,--.011234566789:;<==>>?@AABCDDEEFFGGHIIIJJKKKLLMMNNNOOOPPPPPQQRRRRSSSSTTTTUUUUUUUUVVVVVVWWWWWWXXWXXXXYXYYYYYZZZZZZ[[[[\\\\]]]L%&''()*+,,-./01234567789:;<==>?@AABCDDEFFGGHIIIJKKLLLMMNNOOPPPQQQRRRRRSSSTTTUTTUUUUUVVVWWWWWXXXXXYYYYYYYZYZZZZZZ[[[[\\\\\]]]]]]^^^^^____Q%''()+,,-..01234566889:;<==??@ABBDDEFFGHHIIJKKLLMMNNOOPPQQRRRRRSSSTTTUUUUVVVWWWWXXXXXYYYYYYYZZZZZZZ[[[\\\\]]\]]]]]]^]^^^^^__`````aaaaaaaV&((*+,,-./0124566789:;<==?@AABCDEEFGHHIIJKKLMMNNOPPQQQQRSTTTTUUUUVVVWWWXXXYYYYYZZZZZ[[[[[[\\\\\\]]]]]]^^^^^^^___````a`aaaaaabbbbbccccddd\&)*,,-./0123456789:;<==?@AABCDEFGHHIJJKLMMNNOPPQQQRRRSTTUUVVVWWXXXXYYYZYYZZ[[\\\]]]]]]]]]^^^^^_______`````aaaaaabbbbcbbcccddddeeeeeeefff`'+,--./023456789:;<==?@ABCDDEFGHIJJKLMMNOPPQQRRSSTTUUVVWWXXXYYYZZZZ[\\\\]\]]]]^^^^_____`````aaaaaaabbbbbbbcbccdddddeeeeeeeffffgggghhhhhie',--/0123456889:;<=>?@ABDEEFGHIJKLLMNOPPQQQRSTUUUVVWWXYYZZZ[[[\\\]]^^^^^____````aaaaaabbbbbccccccddddddeeeeeeeeffffggggghhiiiiiijjjjjkkjh(-./113456789:;<==?@ABDEEFGIIJKLMNNOPQQRSTTUUVVWXXYYZZ[\\\]]]^^^^_````aaaaabbbbbbbbbccccddeeeeeeeeefffffggghhhhhhiiiijjjjjjjkkkllllmmmmm[(.012345679::<<=?@ABCDEFGHIJKLMNOPQQRSTTUUVWWXYYZZZ\\]]^^____```aabbbbbccdddddeeeeeeeeeffffggggghhhhihiiijjjjjjkkkkkkkllllmmmnmnnnnnnooo`)013356789:<<=>@@ACDEFGHIJKMNNOPQRSTTUUVWWXYYZ[\\]]]^_```aaaabbbcddddeeeefffffggggghhhihiiiiiijjjjjjjjkkkkklllmmmmmmnnnnnoooooooppqqqqrre)23456789:<==?@ABDDFGHIJKLMNPPQRSTUUVWXXYZZ[\\]]^^_``aaabbccddeeefefggghhhhhiijijjjjjjjkkkkkkllllllmmmmmmmmnnnnoooopppppqqqqqqrrrrrsrsstj)3456889;==>@AACDEFGIJKLMNOQRRTTUVWXXYZZ\\]]^^_``aabbcdddeeefffghhhiiiiiijjjjkkkkkkllllmmmmmmmnnnnnooooopopppqpqqqqrrrrssssssstttttuuuuvo*55789:;==?@ABCEFGHIJLMNPPQRSTUVWXYZZ[\]]^_```babcddeefffgghhiiijjjjjkjklllmmmmnmnnnnnoooooooppppppqqqqqrrrrssrssststttuuuvvvvvvvwvwwwwws05799:<=>?ABCDEGHIJLMNOPQRSUUVWYYZ[\]]^_`aabbcdddefggghhiijjkkkkkklmmmmnnonnooooppqpqqqqqrrrrrrrrrssssssttutuuuuvvvvvvwwwwwwwxxyyyyyyyzzx5799:<=>@ABCDFGHJKLNNPQRSTUVWYYZ[\]^_``abbcdeeffgghiiiijkkllmmmmmnoooooppppqqqrqrrrrrrrsssssstttuuuuuuuuvvvvvvvvwwxxxyyyyyyzzzzzz{z{{{||u69:;==?@ACDEGHIKLMNOQQSTUVWXY[[]]^_`abbcddefgghiijjjkkllmnnnooopppqqqqrrrrrrsssssttttuuuuuvvvvvvvvvwwwwwxxxxxupqiuzzzzz{{{{{||||}}}}~~~~u6:;==@ABCEFGIJKMMOPQRSUVWXYZ[\]^_`abbcdefgghijjjkklmmnnnoppqqqrqrssssstttuuuuvvvvvvvvwwwwwwwxxxxxvsqipdn_iT]=R2Qz|||}~~~~}~~~~y.5;=>@ABDEFGIJLMNOQRSTUWXYZ[]]^`aabcdeegghijjkllmmnnooppqrrrrrrsstuuvvvvvvvvvwwwwwxxxxxwqipen`jVaDQ{~~~~|B6=>@ABDEFHIKLMNPQRSUVWXZ[\]^_abbcdefghiijkklmnnooppqqqrssttttuuvvvwwwwwwxyxrkpenakXcJOyT6>@ABDEGHIKLMOPQSTVWXZ[\]_`aabceffghijjklmnnoppqrrrsstuvvvvvvwvsnpgnaj]eMS/Owf6@ACDEGIJKMNOQRSUVXYZ\]^_aabceefghijkklnnoppqrrrsttronel`j]eOX8Ltv6ACEEGIJKMNPQRTUVXZ[\]^`abcdefghijkklmnnnibh^fZcOY>Ip6CEFGIJLMOPQRTUWXZ[]^_abcdeffa\aW`U^MW@Cl86EFHIKLMOPQSTUWYZWTVPWMUJQ>@=rI5FHIJLMOPQSUVXY[\3Y5HIKLMOQRSUVXZ[]]gHIKLNOQRTUWXY\]^^uGJLNOQRTUWXZ[]^`_{GLMOQRTUWXZ\]^`aauFMOQRTUWYZ\]_abcbnENQRTVWYZ\]_`bdecffDPRTUWYZ\]_`bdefdrCRTUWYZ\]_abdeghe|BSUWYZ\]_abdeghjfAUVYY\]_abdegijlh}@VXZ[]_abdegijlmhr=WY[]^`bcegijlmoiefhijjklmnoopqr_y8fhiijkkmnnopqr`}70fgiijjkmmnopqrbpE*fghijjkmmnnopqcdQ#ffhijjklmnnopqdV]fghijjjlmmnopqeHgCffhiijjklmnopqf9qaeghiijjklmnnopg(yXdfghijjklmnnophiQbfghiijklmnnopiWUHbfghijjjklnnooj~~]A`fggiijkklmnnoks~~~c9_fggiijjklmnnolg~~~}}i0^fgghijjklmnnnm[~~~}}|n(]ffghiijklmmnnnL|~~}}||{s [egghiijklmmnno=y~~~}}}|{z{x[efghiijkklmnnk.v~~}}|||{zz`Yefghhijjklmnng s~~~~}||{{zzz_Yefgghijjklmnngp~~~~}|{{{zzyycdeffghijjklmnnh~~~}}|{{zzzyyygceffghijjklmnnh~~~}||{zzzyyxxkaeffghijjklmnni&}~~~}}|{{zzzyyxwo`eefghijjkllnni-{~~~}||{{zzzyyxwws^efgghijjklmnnj3x~~}}||{zzzyxxwvvl\eegghijjklmnnj9u~~~}|{{{zzzyxwwwv_[eegghhijkllnnk@r~~}||{{zzyyxxwwvvcYeefgghijjklmnkFn~~~}|{{zzzyxxwwvvufWdefghijjjklmnkMj~~~}||{zzzzyxwwvvuuiVdefghiijjklmnlRk~~~}||{zzzyyxwwvvutlTeefghijjjklmnlX~~}}|{{zzyxxwwvvvutoRdefghiijjklmnm_{~~~}||{zzzyxwwvvvuusqXeefghiijjklmnmex~~~}}|{{zyyyxwwvvuutseceefghijjjklmnnku~~~}|{{zzyyxxwvvvutssbaeefghiijjllmnnOq~~~}|{{zzyyxwwvvuutsrd_eefghhjjjklmnn,m~~}||{zzzyyxwvvvutssrg]eeffghijjklmnn1j~~}|{zzzyyxxwvvvutssrj[eeffghijjklmnn5f~}}|{zzzyyxwwvvutssrrlYeeffghijjklmnn:b~}|{zzzzyxxwvvuutsrrrnWeeffghijjklmnn?l~}|{{zzzyxwwvvuutsrrrpUeeffghhjjklmnnC{}||{zzzyxxwwvvutssrrql SdeffghijjkkmnnGw}||{zzyyxwwvvuutssrrrmQeeffghijjkkmmnKs}||{zzyyxwwvvuttsrrrqm+OeeffghijjkklmnPn}|{zzzyxwwvvvuttsrrqqn:MdeffghijjjklmnTj}|{zzyxxwvvvutttsrrqqnI`deffghhijjklmnWe}|{zzyyxwvvvuttssrrqpnWadeeffhhjjjklmn[`|{zzzyxwwwvvuttsrrqqpnd^deefghhjjjkllm_[|{zzyxxwvvvvutssrrqppoU\defffhhijjkkmmcV|{zzyxxwvvvvutssrrqppo:Ydeefgghijjkklmgg{{zzyxxwvvvuttsrrqqponBWdeeffghijjklmmkw{zzzyxwwvvuutsrrrqpponJTddeffghijjkllmk_fY_HI'#p{zzyyxxwvvuttsrrrqponnSQceeffghijjkklmnnnopqqqkncj]bPT`2Jjzzzyyxwwvvvutsrrrqpoon[Nceeffghijjkklmnnnopqqrrsttvvvwxytlmcir_fI=0c{zzyyxwvvvutsrrrqqpooncLddeefghijjkklmnnnopqqrrsttuvvwxyyz{{|}~~~s{ovgkZSe"[zzzyxxwvvuutsrrrqpponnkIddeefghijjkklmnnnopqqrrstuuvvwxyyzz{|}~~~ryip}bi?BTzzzyxwwvvuussrrqqponnnJGcdeefghijjkklmnnnopqqrrstuuvvwxxyzz{|}~~|u~inQJj,MzzzyxwvvvutsrrrqpoonnmNJcdeefghijjjklmnnnopqqrrsstuvvwwxyzz{||~~w|nr}^Z)BEzzzyxwvvvutsrrrqpoonnmSacdeefghijjjkllnnnopqqrrsstuvvwxyyzz{||}~~typx^b:/=zzyyxwvvuutsrrrqpponnmY]cdeefghijjjklmnnnopqqrrsstuvvwxxyzz{|}}~~v{mr_dnFN-^zzyxxwvvuttsrrrqpoonnm]Zcdeefghijjjklmnnnopqqrrsstuvvwxxyzz{||}~~yuimvchPI9\vzzyyxwvvvuttssrrqponnmmcUcdeefghijjjkllmnnoppqrrsstuvvvwyyzz{||}~~~~~}}|{zzyyxwvvvutsrrrqqpoonnmgRcdeefghiijjkllmnnoopqrrsstuvvvwxyzz{||}~~~~}}|{zzyyxwvvuttssrqrpponnmlcNcdeefghhjjjkllnnnopqqrrsstuvvwwxyzz{{|}~~~~}}|{zzyywwvvutssrrqqponnnmlSJddeefghiijjkllnnnooqqrrsstuvvvwxyzz{{|}~~~~}}|{zzyxxwvvuttsrrrpponnnmlVFcdeefghijjjkllmnnoopqrrsttuvvwxyyzz{||}~~~~}||{zzyyxwvvuttsrrrqponnmmlZ$6RPPN\\fjjjklmnnnooqqrrsstuvvwxxyzz{||}~~~~}}|{zzyxwwvvutssrrrqponnmml^AIK`[\_hnooqqrrsstuvvwwxyzz{|}}~~~~~}|{{zzyxxwvvutssrrqpponnmmlb45>\Z[iflqtuvvwxyyzz{||}~~~~}}|{zzyywwvvuttsrrqqponnnmlf'OSVhfdrwzz{|}}~~~}}}{{zzyxwwvuutssrrrpponnnmli/CMeebrq|~~}||{zzyxxwvvutssrrqqponnmml]*'[]`]rot}~~~}|{{zzyxwvvvutssrrqqponnmmlYOFRtnlm{~~~}|{zzyyxwwvuutsrrrqpponnmml\-7fgjzx~~}}|{zzzyxwvvuutsrrrqpoonnmml_ FT_yvs~~}}|{zzyyxwvvuttsrrqqpoonnmllb:&Hkmj{~~~}}|{zzyxxwvvuutsrrqqpoonnmlle&bO]\vsr~~}}|{zzyxxwvvuutsrrqqpoonnmlkg5=nihixu~~~~}|{zzyxxwvvvutsrrqqpoonnmlkjNS]tnlhv~~}}|{zzyxxwvvuutsrrrqpponnmlkZ >%Ddc`smmvzyyxwvvvutssrqqpoonnmll]%GSRhdbnptttsrrqpoonnmmk_/7>ZYZgcjnonnmmlbIGNN][X\ endstream endobj 62 0 obj << /Type /XObject /Subtype /Image /Width 143 /Height 305 /BitsPerComponent 8 /ColorSpace 60 0 R /SMask 61 0 R /Filter /FlateDecode /Length 348 >> stream xR0Q"V}G/d 1mCBuKgS>B_`BW,n4t]uS{T. C37S9smr/c3ֹw)Q%+WO.9g)98sv\|>D~=Jf. Y6QL\=`p)9hi9%rrv9_9)rR,xeo'۬+'CSx ;uX0PC<|aF<`X> stream x흇CG?:]kclƮ{^QbXD8Mݝۃ(̼qq9S@)2pq9*h_Gͦ;R+pVT<8m6 'b2!M3#c,7..8B|dBx4n 旄dv,27C5BբQ$_..`}7嚬VۼLUoEb63_^o[V/rcŜ>_ޭ7l6G<,Mak>VPzst|+(AK^ew]t:t*/MP\I5HNZ~zO:(*.y^kAǪu:7\80:a</W0Qx #Wq0te Aԥ֖y$׎+dړVQf^C+UE)$Id~\=XA#.4䀇+iH~z$tjxhsD=:ZxՊ*x$a8_Ei}Vڥ.a[/$WOLǯ4KS:DW6iPGTEZ}SzqD%-<谐7%_C+emM<,ͳ(:[q(8С7V_ s2-"}::lyCGŢ1:lά|/\=Cc[%Iw0BeȚȯ*W0ey:dOcJA"LσOql$!@0hQZ>W3բ:X`rrHE3zad鰦/C]?\f#r]>+tqdLيV6\UK6A :;P qQ_/W4/gǾ䃭ܩ&5>hCz$9P[)>V\S𠵉v->CpNG=l|9Q t(kUց6=ЊcRD.(l29|BAJVFJCihLrG21h1_:Tp㺕^he:\]gc઄M .ѬGGfd ҥC6'd* $L`U'V\T`}-.$t ';uH<V|W5b%tWt2+*0h鰕AGp3CҴNC21S0}ߨ4Ɇ7%:Zͪ~:je<yÖ͋\e#lʩ8ks:j}ЎChղ'P6jOCPwhZ5AC+lICypu;zׇzr%KAKG*t!VͧrTf>ڪTp[冇j;j4Iؚ]dR`6BhXԪ: CC10r] tP8RDy%"4|^ļ*0tތFKp >6aUĴ;d8 VNC+i-_n3{0 S`2UU0604rDG[`.\ wROj-jA~h Yʜ)%tp@<*J^kZM1r)eC"XWt_oe]U`ŘG<ѫ7GPPĬ[e 6 .̫8/CTo,gPҎrFu5=q~mg;;zˆ]wۛ?ZVV@{[c;jPYQ io1fgZ$֧uSy/'L:hF@U(xbQMźZ?CǿZ&2t6<%@j:++$BTzE`K6f^,Q!}a.X8PAWv45VF"}]EP:U r ǂƒrSXҖć[hxu ѣfy ـh#FdQ`T e+JQ܏B>3AM$!Cac1UFK㛌GU5;ZQ %DB;})I8"L# Qc*EnnV.$D`Q__|10[ES|B?^p%-1vqX*FNNvvPvvvNn.4b}„P>`t]x0l^c+DT~)6{$Rg$ysO pdÇX>@B",^Qƒ=Na}4V^g#x_bW'АTU/R?~xCJ e0濑تy?!U R b67áy 0'UkAnVԏ޼~۷ ?} zxxౕm#t륶ο2[8_r{ n7GYr.XΑ}W/?ٳ/ ! 2 I|B<{T*x#,,{yl孈jF@mҡmt8̶r75TUV%}WO<~?{)4Ɂv]qҢN=~-~Sk^+}!K.}ǍOX#Kqߍ};ػ>&|$R +\Ѯ )A{y>>*<4x_ZvϠ4hL7vuAh?lԅ$ǭݜ\X@J^ ⪒y>$wuj CضБ]|VO,_%!9RUV<@ߴmuCa联 tB(i ėqo_LX'Μxd. =P|/ͮ1q6p{Jbh8:RNѥ[E^S܌O\97o/8w*Ih3򺆇[֊v2"먭)y^oݹ}t"[| ;u]@v>@tqN=TMbBx=/˭^}rwmUZ<:K"9ظ ZGeoY޿yv֥3Gx @L[} g/^BHFŃ`ۣ1B4ӥ~.5N_e$!)9.)(N%r c;;8 0d.>zӏ7(9GxdR6$$aHςKAf2-syN:8#tyG{ވکI$)AXUÅ`͋޺vd;/ 4mq(Bԧz zt@1bɹ/͂$uS8l:p0xjSd9NJpLѬ)9,X{wڹ{oZ=…' o=}Trh'mTذX>v.(36ơg]\Hdq>UnYuQlV<f*h_R_>tп[׭Zj1rQ[e樬[ͣ I lzU]f%;Oੇ^<> A!qO]pk.`C (~BqLG1}VwEۻ} 6Ǥ)Gv= j Аo꘯&Qz ;^u -ڶCO,Vʅ N-"?iE& xPGqQa^n֗$=֭Z0*kr]fMLK&9vf'$|rpf&-8Kl8Vv&cna!Vp`C<L$r$|Gqn]:u-lAT`쾣N,!-Av.L_2d?O[I38UF.7\7Gz >6gc(3:X`hhE (`i2)Gq cwo\@IKD#e >u81dz=!}'lܭNqkgjJXRnf.0Pf&_b@$fDUA883>O|k0)ߴfŒQzN(E <5C{5}/=Ta%i8Tz{N!زE  HJMCS B]0!onlh gCl AF%cqc\kfjNVfQ} k Ҏ[l/Cު 2HBQm37w9jM6vK.B[jPeJ]OV34 1  xS 7, "E>Bmm5LP>91WOKV<@BO!ڳ:C_r0d8molShkm6,ҡ_} 6fR G)\A&je7 ^Ï@qj#/;L9ss2?~HNx"aKg۹;6 o6Y  *Cjڙ mW;, h+Ѡpi(nh* 5լGjzv?_[l3|p$ykNٻc?,>#\oH9G6dʲsml#"'ɝNH=&ZšBÇah|fVKC00'd. U|D@F@HGhl)/>s'g_+,9ʳN@hCIU\e/ t0gcLFEDCO՗fCȮ=BGtsL8:aal6颁ROT RA./970gv3hc/aCd2Lwؔv]}_c0Yt'ȯmPbU e<,̄)ʭ d40`0;/X*HH%| E_A‘K]":ѽ7?};@R|?Ey>|ɹO {&{~̣sOV~X}Qlj7} Yr& FPcT~ADʕ(C&tFY$ j6PCRa#unёAQ +O%D EJH-@*U|xqܸzɣڶX_Ή6Hֱ^ۋ&Qm7|^fW4ZtWBͦ6UT$~Q6mx$ =#X`&@99٬g9;O2"9B\GS?KN|%J9ܺ~ٓY҅~pBމt7 9_',.|+L*)gh&<VM"A=@hT6 d0DVVVff|S+33| 0/VB0yA@L9 d8^<{nkϟ9ywlYcgth+zk.uou-fSbז;V4Z:¨US!@D% qfFzzH>}_Kǔd+(,?/?`#doq:~N̍+ϟ9غU/Y83p:EeKloBɍ~NH=oԤy<\@moF H \E Q[!|eC,22 OiiiT)!, d$ t(;xo||.1Ϟ<έk/;u(vn7? tqUB39 &vB#-y])#Ew Pe2ȫ^fb^E}B3A;ԳZQͲA=@9 F"0"Ϡ=#z<>0A$@H%#CQ ٸwUϞ:~wlۼ~_+_x/?j҄q:ܕwtg4?-ݻ ߰sןx򵪡Y_# @lpaAЀ&0zz xǏOAV0%/^"F g( ?};17^:qTϖX׹?aʤ ƌpW|\ l1B= (7jo;.g444̀V GlT-HhAvl^4a 8ģG݇?ïCNJ+! eqOlܼv¹'BkW#Q&O?v7yGvpd,/Y.α!;E3{ҁtd[VF(I:g)R8*6 :FT t'A,B&ݻ{nll۷&ߺ PyG@ ^`= ظ~>wlX4i'=jİ>wqQ6533ʦqM8^@ 0oG_+0#ȵfHP`h R. @\@RO_ .۷cbn݄A>uVLL b„\qO;0 x7`ܙGqj%iN?vԈQCDp:U:>:Tu*;ՆECL wb|ZKw]yĝy e8rsHHlg1_X@(ׯ_vիW__Pu Q ̈́P 2>[7. 4&OLjaC pvq{MIm.cG<]صdͧq޻AF^}Nr~yf-J:.OYC,p:@>72p fK.].^t@ A"Xt и|Yqٵd+bcqFD зOxXh=_J/ M tAM6R 㴢zUUq |#-T @hh>&PVP@*.\8|t9{(&L_fBABa x.D񃰌 U+.?w)F2 2"4$(((0Ww/yG[ph Qi6숧1>p'{ԥ^Zxƈ8xNp~޾SӸ -uSq ӧO:uR֩Sg@P0%S%(v JT]v%o>y\qu_+2k   c`= !5ơbE6 )OXhG1>F4궎rqyxe@ѸyYbq dO?~ر=t I4](悙 r 0طsgO5ZE0#A:Ċn49hQJ?tr<φyRzz?Ǘ8 08bФNrq8U={5n\d@X8q"qȑÇ:(A)*@jL(`?Μ2pEfQdvrƁ*6\2PgI5T/F9x쬥v:SǏ>x/ ͐?mO3&>B`ӎCu:`S+?TPcb RJ-Qg%yh~Gr&OE@`PX_⿶0 )7m޴.-_9&SPNeoZ3q!.&xt(\%hlвGffyhDhZi 2v܈J,ϰ}JGJGL[fߥ矋[x 2>3e/ 2IXu& (k&a&?bT5B,$t(Aq@k[dZv|'Y2WtfL2>*a(-))ƶ\'hMw9}G_pHJ8ȈrjQ69f)ptI!v_!$660B>%kA+Cdߩ3?\o048 „ 4FB,Hd2QN}$9êEUy,v :`6\N"Ce 2WgЃ'q9Zp#)hȬ<0D3_㗯r::r׭C-U! W!4PXK!:4qIuP4:0-/AHtߋ 95m:fZKUu5<00'Ei䐌x2ӧpFAY$~"M/Gq%QZ@G@|r"9NWsH.MtF@f_ñdfǙ@g8\TOؐtNp. sOt*GYO@Ժgן?\CE!i 8,pTp9̩)7OO@Sboߺ~9}c&:ig4YR>3w6XsEvm\]PPaWVˋf0G8ߏݘo+GL9|` >]2y䌜v82|JW7жS' j=pų9xX0p epuL=jcO]jJUa؍96>] >> stream xW XW>VE`bA~P !e Ԅ J bAbHZZ+hG I ZE{efB}}wko{AZS&Q(llS\M\\P^x@g_HN\H,,H E &wBo`¿yl-Eޞ. D'Id+h44<G8?d'L%g(;hY{Q/+s)?@`ACB981ieOHs׭߰q漂 ? yE/+)յ^o8_Zϵwt`0._zzϝ?xh/y(Ȼ- G d/`K E ɩvvXp@R gjRF*4uw^Gߐ3uM%Cuԓ*`iV5še\*HVR]f'+gނi6ҀԠHJ)G8q;=[Ept N5΍N)BӔR>E8ּtf[ɿe-܋a|~!}` qCw^.&tл `+p`xFCء5$ȉg Ďe,[O^;3uu\Bo եԪn`]a+yU%6Y+kiRUk먨ᬮXjjnx`f$ݪ deM[rC%/ T4͑,Hh\TuЧl16yCc{fK>wmkpA>u%VxcKT,0:vcҤ _\ ;lM5AKN9;w}yHGq妲IcRH=[nuz6kz]ZOO_'ZXu+ I*3OA\oQcu:pSzTllTWiV.s-Y[\z2.<һN *G313UNcpczH*&Q&iR!K@DzYP֩V+"q@Us'- H(5I=03r0W՞*?#?]%lHW~+s t]zSjjճKx94v jr9 (o`Z3XNZKz5Aa8}Hu~L ÈbyzơIJ |spo+/,A,LDk"n\l7VVagI| 9< nƚ ywWVɢ9rn&Wemfhd7 73̂QJջg>t:z j)<MC}ORs-䶌I>>9+bW$o[9/Dư)|Y eޜ2!NDA),,ESMP9g`#D><(y&D ΍\+$1;r%4u<=hUOVd9[qQUHdR¹z>!謹Ƨuo(H @+'.)IQYl͐R1U' Ȝ,K6UֵkW4(hZ;1T.P`iQo}rWU' :Eو3[*ǰ?Il?li0{Z0 K2 2ń*Y>9m!ZT$qӵo8e.<C: Iمo$kyZjL3Ta͔!"Vl"CWth:=2Z혃5)*Ul^:+0 bUJjݟC99pif`afa ʧ;ڟֽӸӡF ԼJiSV\>뺞%b^g T8D-^h[GB2L##a!Ar:>=9ĬPQZ63mM5J@t`W¬N6Iʉ l BfңK"zu|b?8 Hke-OXV> '>T 0e۳hB607Eʩn*KћKuEymK`v лd\ C`l;3Nv^= _g Ƞ[nqyvT*ԱY<1_C,U$Kunƿ?+$@l$L8 Ce@>S5l~D8;}w5M2.|צɱ4.H$,'k3J`\NGO@  BH@ xg`w?p1R\Fx0PW Y/ꃕ`"BW.*aH ]Txfj"0wjs[=rVAt`t)†K7&O>UP'$8嗩'5mY+(Jm|M<3~~ᆟ7oWZǣ@T,ZN`l DIť!`AU&+$w\ ,(`!'!{ALUvŦZ-h*?&`3mh}l{HàwTԅXɗM'TK:2-4`' n8< BRՈEfQBeOu30B(ә%mOvM5ū#Ydp cV>tS.qTwgWl0Kdm|ˠ8:[kUV,K=cj4+- *,nKB [*5!_fUfySN%C$ ^/![dgPI]~O$$&7+q78?>˾<L"%4gWj@{); ͟.1VfҠXjT|%Y@Q u.7|B!`k+RGҧY=5u_l$fFs$j Uqavaȋt}Q#H?'FVtW(Z>"Vǣq.BL }~-I 9}9+f|u,h=(0r%ޡnY_jߨ 珙g.zG>=e9̭[ $ GJ },s%ɳ>-?j !Ȟʁ}T#% djM]#N,Iٝs4n3Oگݻa |gsrcw-w5s,Lj3^DM22W@7;ݦG :Zp\\|^(GuGoҌ)@_25C 闳NW4VIG LK-7iIߨa2z_*ށ蚟nu'0ɔ Ka:>FSD|4.嵀 l+3Bs5?:'Hn5s0hs r[SNj7me|9)0sYV$lt55ܚ;AMss%P 5Çg?%俉SoEC ﻐ7EZ'ⱁ75YS&fl>d6YN6G %wxynUDz"$!$QGS 3&O@o9)b:z7=3GðaO1e/uHSl#ErYiǓhWɊa M $l*OJߕ@[`=go} (#MrdO1+x \gi&ߵ  GFj>2j9\FL9B oX5MWAlSyJ'gk<i;q~xFTjKW w96+|'ߒMm=oޔW.4,٣PA{uϿ&)#,= lWaݑêEE 3FeG-0{ VC'v[=$ PS8~`䉆%.dntR )~u?3A<;cڍHoG_fuOϲ[;}[;n#kFDJoAyԼ/@Ț ̠A"ͅڹl 9XOѽe޳ <5Zm˭neq#h{me@KWtHG zc5PqXyP'×KhX,a񢝨~/RV;|Mֆ2 ?C]RXtp-.'w!I]Ŀu'X{UZ<[@+DSbLYݍub2'!)lS=VDK[NNqޘ_“Q@V%N1X#>47>ѿ,{8|x{Z^.$nM-@r9L7wg l:\,p/gسBPfJg!_lF!1QۘycrjetqNKI,QQtb13FCxxX(i٤%)*k[U_tV&:܏9V vzA/uaG?y T }İ6v}?}3XwxKOpw~ }j7koցQa4s$K^QZ ̞p8WjxzɆGryE>~h."q3Ӿ{=VD$iԱG4`[fAG{ƓcPo}l6.3'~lȊKYͧ}6{GkZH~Ot?T-EqP\W+ 9kxmH x}7q~;6kR[p?\_r|-\&b/L>Q09фYT4S+^-؀1UK?bvTMk4}PW^7j> endobj 69 0 obj [/Indexed 16 0 R 159 (\000\000\000\000\000\367\000\257\357\000\367\226\022f\206\024b~ \036\036#""&$$+\)\).f|5n\20397F@\367\226ABjAINA\367\226DDFFDFF\\eGYaJJLJNOLJKOLMS\201\222TRSWRRWoyXjrXz\207YVeYZ[YchYhnYs{Z\\^Z]kZho[_a[hn\\Wg]]^]hl]ow^jn_hka`aabdc[[crxd^adbfdghehjempe|\202fhkfqvg`_hjmhnpighihhjedjfgjgjjlnjopjuyjv|lfhlhillmllolv|mhjmjlmllmlmmmnnfdnjinjmnllnopnoqntwokmolkollolmommooooopoprorvpihpmmpmnpnnpoopoppqqqllqmmqnmqnnqnoqnpqonqooqopqpoqpqqrrqy{rlmrnmrnnrnoronrooroprporpprqsr\204\214snnsonsoosposppsqpsqsswytontpqtqrtssuqpuqqurqutvuwyvrrwttwtuy}~~{{\202\236\220\213\203\202\226A\000\226A\367\227A\367\354\310\017\367\rT\367\226@\367\226A\367\227A)] endobj 70 0 obj << /Type /XObject /Subtype /Image /Name /Im17 /Width 43 /Height 49 /BitsPerComponent 8 /ColorSpace /DeviceGray /Decode [0 1] /Length 2107 >> stream  9`l  .q+|VU] *m-$5|<2ę<7+2"c*Zv +& ]7 ',Ifm /X нv^H6j ogP<* B 5.8 Jq"_N 2v-B Zt [;uYAYj(: ke B _ENS\gq{o!nx h  M ( 5yf AigB    endstream endobj 71 0 obj << /Type /XObject /Subtype /Image /Width 43 /Height 49 /BitsPerComponent 8 /ColorSpace 69 0 R /SMask 70 0 R /Filter /FlateDecode /Length 542 >> stream xw02eC{o(-Hê[8& J)PC_lˍ}ti~Zچֶ,K"َ=_~í#^RĞ7_ a,s3FϤMxM+ @ }*D@[3p ۸TXm+L{X3JV2ϩMȇ\0]ZD.PRD J䣦 w4<دk%mNqy:Lݕr&X뗄/ D%꫸KJD^[Ę'c`[߃3+@]DȪS΀{n -~"ٙЦ>mZ l6h\uҐa::Gu8 ɩ͞Y)V65/8pqc(FtUU#>>F?DVwˆC/DgIшm9>ޞF|#_@{ endstream endobj 74 0 obj << /Type /XObject /Subtype /Image /Name /Im19 /Filter [/FlateDecode] /Width 41 /Height 47 /BitsPerComponent 8 /ColorSpace /DeviceGray /Decode [0 1] /Length 459 >> stream xc`@|-;^y?_~WYԢ6XetLe+^@5.?g־^W\^҇]B]x{[=Pu{/ʀ 4 }@uq_PxW8-ap@[Is)`8#|ĩ[>8{~鬞ZF߼vN HdV|U+\ sl3 TG/'a\ B dț`x`طX<0:QQ=>Q:3\ J~D*ꏈP{ {R_mXDHwB]BEŝPD%mluκ=Hv 70u?Q'R!ig8V;*j|upJޭGnݱZ CMe? endstream endobj 75 0 obj << /Type /XObject /Subtype /Image /Filter [/FlateDecode /DCTDecode] /Width 41 /Height 47 /BitsPerComponent 8 /ColorSpace 16 0 R /SMask 74 0 R /Length 1000 /DecodeParms [null << /Quality 60 >>] >> stream xmg^N.n.^n.n>>^~aQa!!au9q=MC=M]c+/;c37s]pG7 #Ĩ !|||‚jj$94ag``de(`dbfaec:`#33 3++ P("*h&ȮT(b8q!ƃA?'5qrKHJkhj[XZ9{xzGDF%gdfWTV5wtvM~?~K/&fvA YX ل 9D&.xS8hRE.1A^853|bӱ2ĞGl <0xl˧m{ϭtBSBY͢E wyG}srU֮muܷS/eIkLz@tk3OK*uSZ*bC$~?[lϫ?n|10v>YUf,z{ cFy'Mc Kօo.}l> endobj 78 0 obj << /Type /XObject /Subtype /Image /Name /Im21 /Filter [/FlateDecode] /Width 120 /Height 65 /BitsPerComponent 8 /ColorSpace /DeviceGray /Decode [0 1] /Length 3098 >> stream xřy@SGg潗K UQuZm}QţQURՊڵ" Zﳵ"o]W y]7~a;A z+;oD8\\m Uz&\lTTPws5q@炱E>]R[;K9LK?Em :7ܒR;Xr?0I"[X[otcM=6p]~j[| vJ7tNMM~Иr]OIʶ`\ć7 5uYL}8ZQ+l]_'qМ"M9Cjʚ\03Ei{3[VRd|*nQ٠y1GQ+_٫|ltxCFF~_Q c4| Wv&fay?` ;/ޭfAœ{xcc97xoS=vY_ -hvLً,GDzqXD6IV4SɃqb˽9:r9Y@>b ņ˖#yR=?gV0`EBAzaMr_[:LWm^s*d~2Иc bSV% Z}_"|%؞pҘy|3ٱNm{.wȀ lxRHTe[k]`|ULūӻ\`bdsakǂ;Y=6|&Ɠ1&r?ܸntywQ:Tr5>mӶzd#p$ URn> f<Q\[`uLg3D"Eu:g4n WǷY7]܀A _Ƴ>{]ĺ#o=H_~I =ϔK8&Bsw1-ZTeJ¹0aM4QnЯ*FnKp/pz6[b ^cL? vƬ8r1iK0.Dz#.QaC 7czt7'[!qoUNiՑNE.ޔ>/ձz[] oU ~+nG5]v:d0뼉ONY)Nѱ^gnJޱkK:|;y%Y$\˟`$ݘ6wc䲁=dxwPދc& [pV˝*#.-t*NџEٟ|;'*tkcwKұȼqo2~WG2HQ!A҃&WM|x+m0}0gm_m( 7LqdnKmfӳ̤+&Rr:YI\V'){$N?4>S\džXMVq+I6 y񕸞gL3D tPr$k݁_ZȎ;[Ո+_\}[ںlܖvl_n3Wj/pDAD.fi-n#tdM HfbÃT0ӗ໗<#ņ֍ϐnIl);iq۟!K(QNP+{h>V+w{/j qbD/Yɜae^YgDEfEm+wjՆr 9܁bNd_Z;i}_j,ʍ^ DKV |O )wXEsoe]+<2G:iWMFv z]%`\܉a!R2e'^wb =IS:ׅTU C"& }lhWv.V 'r!3i۽Qn[ oR2=YB%cԾn\Gqֹ<>нwWzT+1߳b㊖L+/_wrչqDs X݅f\/y% t׃%G.@}-[C#g%~q=V~BCߩ{**nd6n o%hE6B^a)~Bјjg=Zt`*˼W7jB"ߙjH ;z@gr񧩶\$b|x-n#ɪT`fqny;Mϖ}j`klu`٢2`b??gઌKL&"ILۈD)/@p/x]jb͓+*MfJ% i/_0j+.l5&7MLaw(WծI a$*1SSD..wKq)Fah<3G@{KgrAuPvpW𕮈\q D Q*'fz)XebCߑ@"bTCvŠΖ! Dbْ$2z.tS(5zf/8l\],:5 X-d-D$9Y l?%U.\Y˲C@$.pɭBDA$p&q[i YHÔ˨[.t`Ǝ艦Z)f@ v7E&\ HuMK :/Id 5*=3he/!r[B {$)o8HGYĨv.+E(GnO LG6zLҎ, HX@{_B-*d~E, mp endstream endobj 79 0 obj << /Type /XObject /Subtype /Image /Filter [/FlateDecode /DCTDecode] /Width 120 /Height 65 /BitsPerComponent 8 /ColorSpace 16 0 R /SMask 78 0 R /Length 2105 /DecodeParms [null << /Quality 60 >>] >> stream xy8ԋ,L&3L蠘 Xf, a dd:MRAeP:Td*k'b 2 sts~}GRvKIJ@"J*ař8uv!;I?p,BV 4$=K Ru$+?Cb];G <  A;;=E!U,e`jT9]h{Q% .|^y}ZXmC#c<䨵;븷OPτE^rZJjZzF~z :yUtG{|/SӼٹoյ낍.3хqP@@Tđn~.9{%8*|^go?h;X%߮a@yz Ż y۴& 3AiwU\7p~ taqwvU•cm?"+,jG"7Q?-"R*:\oD`͇=+#,PHgGFS;Ǩ[OCwIA3q5:W֗9cX+i$SN Imie6+u[1Z!~l\^|@LPCӓiؗ˟` 0e7]ށ<-Ӎf|>U洌PKz7}i.{auYZ[ug^P:'N*maM*ہ;xy?Aifoa8\ŏHQ(j"0H_ =ANeח5*[!y:BI9s{:n:~eLT̐8^%5Ȧ~`!pm'-/}f6h~rձ7wʪΗRTroyv` w (ܬT#S/J{O}x鉂8߱UL$:@$3ūGփ ];cjЅ67պ)ޝ$TQkGG#ܚBbP̤3Ff˲Dh/#>tGvۍo]o4*#iC>-P͍Rk2iH;g^qoݽm/'}ڤ Ԏ 'ߜ+gsJ R3*3/_ڎ:*q(!;%ASX]Cn6:p8:I+$,‡g] RXdNF8g*h2,I IJqmfȨayS {$;cJ #)ßjjg ?bP\SE[_٢MJ^ʙ 9&_LYdžtS?:dw үa2<=OO]n,"ku3*]] W [mOʬS#Yd5Clu⼖T@hy;vѼy<%Y"/] xreʏzy_][f,g_BZ^wG=gն}-׼9gxDm)y7$M`$Wj) BS^⽸ꔔyA`|3B+RjK/œaxͫ96$mV*VPb1MO=Cb_rYmyw(^Z.8"ۋZ3۳[Uq;D?^F8m+Qr*QliꅉbŤ8ĬU-Rk Mu,y4<7tb,S, nZe« J^yHFF SBE; [6p;Ea-vbTE+;Ң6*t[Nw')g_4B)`Ex[niJאT $? 9"]7M#eN $ v{-|ƓDMs&DZ}ӏQuL*1^ICcKhG4'+ ; endstream endobj 81 0 obj << /Type /XObject /Subtype /Image /Name /Im23 /Filter [/FlateDecode] /Width 119 /Height 63 /BitsPerComponent 8 /ColorSpace /DeviceGray /Decode [0 1] /Length 2461 >> stream xYiTTG.@-F31j4cHx35eq?5\ȀA\Fm aE6iVAƶe;u~I$8֏W{_խ{{!>~ duJp6]X3̓#= 8> >U= *{b^:SКpg ڟ }3{.eYEZg`ŕ,@ feBe/A,iZ0[<QF:"R&>2j+}SPA p7!K] 6Qf(z`Z>φ mmHķC25N< QvËYrL*'^[]d* tкkN֨20a}5N̎$I$Zۡiw %ȀwAWБ<I,Q^,fr, v K~u ;k8UlHœ:z? h0^ NM*Q)>D7Zܤqo[8BuðA'ePff.c1ЧM32A5tz$}Oئ2ƴ\2X !P0]f97GsT!dY-и*A[^L4~'>0hK.@s; 3SCl_-.nQ%_%+exeHKqٸ`0h'Ys5Q7ˈ-㳡uʍ2**_Y\Ȧl=UV '1@+r(Zp΢4URݬTJ&ӌe:'\PAWPx"5-+tu*=f9V_Nهk)N`3+ˢd^!\m*ZL?yj FAC,}+("gB!kᵥesr\y+޾Y7c^/Y4M֏  Io4vTӰ@r;Ynir 뉧>f{X O;3!L ~m; 0#4Yk'u k:Zmb9] R"Yw)0BzppV-*SY̻iGpIJ?sZzX(&pߚRsQky'DG@!cдrB9So7A)yp>"ZNN< `-k5!qȭ#>~pmV귻P *eVGX&O0QEɍlEA 6?1 tkcrqF~!,|odJ]jMϩn>,Ljΰm'}H@d \RQ1;&hVuw̙<=Ē{(5+JŢ:vjT8 FǬkxs<LDq ғė>pXd1J9ZY-sTy`UCtp`啹'B_ r)%$WLMb<-aOWd(7鯿7X6A# tqT(5e}Yrii:pA,.W 4 mn^OG(eL&dx 9C^]}<-؅è@w `࿲;MI F]rp~VxAr/U,%k6L+ Hu'8Cjփ֯SD:r4?vD0(JDCNdDuΗi{uQdSwzi~ !:SM[J$ϛ2H X#Y,XൃG4.4e &B\澂Y*uCO՝}YjhR!40`隆$Hf.gǮXlJ*ẅ́l? %Dр$UF[5Pi*(Dq=OfrG_Il2J`=$f̥ʚ| 3VIȔA$QR|ۤFjtz @:Esx0 tϦ=Cφcbj$Yx61f'=illHQzWk(r WW3dyE)rKɫKkH]z* endstream endobj 82 0 obj << /Type /XObject /Subtype /Image /Filter [/FlateDecode /DCTDecode] /Width 119 /Height 63 /BitsPerComponent 8 /ColorSpace 16 0 R /SMask 81 0 R /Length 2563 /DecodeParms [null << /Quality 60 >>] >> stream xwTY_ JBAC ! 52RAj(P#FQ@%(R:%QQ28g?~>SYCHKJJH(cehMQOWkɜddWgn~}=\Ah`{ ] X*F (P W@a"pK`B`0(t](Zh)"W'+jV=X)0*ETLV'C]Cs^2iσ^އ =~ds1qS.gd^_PXtFʪںo𰣳d?}1>̛܅E޻_|[ ?P.0 @؟ ((L(tDʨ'#0VQ5 60jLL`FO_k@B@Ã6ꉏE^-LuGc Fs*q8kK; z ֥] }([yGDž A9Kt~}| [xU/ڑ׷^=)=G*DgLs9qdN ؼVJt L_^xd'JGH,`"|Ո{Yo~^nVıSj701 e7Z~X͕X[ܔ_&tdU|X<*6^,\yS>00^L:u0 ~y5&,DWc 뭼CKK._ &.MJJrػDCVѤZʰ+.p[Z  PWl13~|faa ۮtݓ?9}?-jsu%2`jbsQTǫ q)\LJ[d 펖Qkd 5{@?wyUY'd%<fdVMe+-KYKbLCg> Ns}}vngIA7>{oITJ!$hbQAb}UA^zq.X,*]tu xx|& >֚_ MdV{úAO.$[%e;|]y'mǯ&+sB 2e@vU%}:f:O[U\Rz[&;>+b PxauHθlo KU}z mT_4G7uC9ӤRt;!La7oer7_Ҹw?gq6 rN)B8+>/ʅ;gqtF/Ҭ1NJʅt9џ#j A7PsFdB.i:N} գ8z"7nc[A  AO"#{F0(ىu ҌJ*y~\ A|Aw!Ϧҿ[ L=)8Rʙl  kP; sMH)RSy݆V~78i)OB8CfHzN?V׫ߺdJ69FH:}kk8KεmiJz#'?lG;RxkO"q^cVOp\@uMZO|ϩ7Ҥ6ׅiGgR IzkT[q&p/wy:,z»rDZHiD;c]+`2]R'v 3㶜G ә5A"sa,l5OeW*+OC0Yr#ƶfOIߗ\KTku1lL,w^bRoT  "8BSY[A/XtE,QNv_Y{+/Vb蓛>ůNxvzf6:>=+7~{pD Θo=ݷ=V>t*kIwi3S^NZ%ʚ5 򗼿 Ggk Ai׹IŜsrDeڏ<i)~L|$P9doҌR>G9pD|M$R`aELbv}Y|UN endstream endobj 84 0 obj [/Indexed 16 0 R 20 <000000001BB41752C539CEAC6F796B70766B72777077746D77756D77756E77766E78766E78766F79776F7C7B727D7B73829E90995CB4B7CE78B90000CD0000>] endobj 85 0 obj << /Type /XObject /Subtype /Image /Name /Im26 /Width 9 /Height 7 /BitsPerComponent 8 /ColorSpace /DeviceGray /Decode [0 1] /Length 63 >> stream :9 NZVTk^$xdf`Ed/z>dIn)< QC endstream endobj 88 0 obj << /Type /XObject /Subtype /Image /Filter [/LZWDecode] /Width 9 /Height 7 /BitsPerComponent 8 /ColorSpace 84 0 R /SMask 85 0 R /Length 53 >> stream 0@`(A@\0 bxl\B1X0 DA ` endstream endobj 90 0 obj [/Indexed 16 0 R 14 <28282844464F46444446478553004361635C656F406E7676837A778775A78D807C8DFEFE8E807D9592A69594A4>] endobj 91 0 obj << /Type /XObject /Subtype /Image /Name /Im29 /Width 9 /Height 6 /BitsPerComponent 8 /ColorSpace /DeviceGray /Decode [0 1] /Length 54 >> stream ɒza:۹琪ѓɋs endstream endobj 94 0 obj << /Type /XObject /Subtype /Image /Filter [/LZWDecode] /Width 9 /Height 6 /BitsPerComponent 8 /ColorSpace 90 0 R /SMask 91 0 R /Length 34 >> stream A@BaP$,aРLBQd endstream endobj 96 0 obj << /Type /XObject /Subtype /Image /Name /Im31 /Filter [/FlateDecode] /Width 619 /Height 159 /BitsPerComponent 8 /ColorSpace /DeviceGray /Decode [0 1] /Length 13017 >> stream x흇su罻  䀜.3⮬*Z-[.KW}ug_U\W]W=  W%i>}_ٟ_vB=z\.6CT Nwi#FAtc4⬅#VMa&r /Y t{OobQ&mO Us=A0VsC26~ߋ(K BRfH ϢnK Ǚ uV_ 2&Mvs%͈ϐ3Qi~߷] :O=aź&b5/DY k'in!# Qh h eLg2T BodHY=7 TxNLuZ 6 @w̏{nc5 M  QsQք >NxS9_٠g  ?@ M`J,6HD_u8K 8kT#46+pz&8<G&h߷q mTdȠ*Pt3Pp&?Xdeao9&e2ѨČLT \/deTmj􅝧%gB,Z)&@Ŀ+>3?N8IF554D eR~lP,b@! ΢Qy Y,/V.a˳MҚT<'Ti5ԲA~S槾vklb<9&PUg'Gk*lF*DiJhYNxMYaz:oN\٠g6gʲ7iJJPϺ]ue]G4ڐ`EjT1iv@Pк-NO:4HC9D-E5H"Ei%ä,%q\f,et~FR&3L &f[ @kZ%He5p m_?Uj>*#C.}QjsO~M 3 0Xv)xښ nbo3Ɔ"4۽rS.GⓓZ SQ-)"R4E(F95!5(m|h&Y:N 3l$g¥Y\9o:(ߴ~é]f >Y]fDZ=1\'y3'=yP &ɔ β23g|MMTm?Ue[H-n Zđ&=))BLgí'_VFaޓD-eY z$j 1֘,6,6cga8l&@9r&@[wXkA[k: pr Cl*@sSYR}_:0,>~8Q!1 2k+Fd|?F=R3.'m&25eC=ʄ㜛/;Z`Uf೽ɺ:S(zƉ'u{X}GIԴQ*H$ƲFU5ZHI&EQ94Z@U9 +g"q&⳹l_W2-렺,թrMP"h>[UYGhKib' "QfA? (\e({ct܄*gS$gg 4ˡ :f"@_Oe@G0e|s+& %ZZ~S?t/$eN ֏#h=P H8Cқq7ʙ!bEf sc.UrƞK7c*N:j.4AON%8OYb2jPQ&bmlL ( F,a& #̀2tĪTGaRe^$ΦZyPos_\X2DZTz!*2j,Ƶڸ 3>)1633^saQR&ԩ²vN+JY%qFY[ iv64,P/Sh+j DlBMh!ٌ' ڂ2 X\\ZV}]fX#CwI% V%s`efP:+Θs%HJ'mRk &g LP2R3TKԆ1 9jƠ)5$|TTǙ, 0Ƹɜ}rv6x/4? ҈@FN@s9(С8B9IT'D 2lJi$S4ϸ&bs,6 RK`yJ)v+uS&Y*|j;i$B^P~ÓJJN_N椊Ѩv恄̐!g j&" ,hFebP 1jfZ r{ Ak@(UCcC[(gw9xm$j$+ƢO`m82NS)8D&Mk ΠA%40 rM( Ζ\[_v`I6lRp딓;]. zUw ;Oh)m84.E"㲝Nja@CV'rj ln~ C)jVJ0eX^n0+5h$Zz딒4X?0ȜN p b=(:Jbe A}t B͊o h+ҘVZjƧKHtc޽< YY_aA8v5qhT6D۱%3ܥ o<`P<4`ccks&l.`rdy6A"9yJZmCs |/_͋G|05 pT:+Ei6B5Hd8̐?T@Mrl08MX]͍ͭTjg*6ӝ&0PXM@85#bW!=yir:Q0g4I+D 3\v@7N3bm&;533yͼJ'IWhUs I8 \4M:&D6$eH&%KEvTX"7|1cw+<\\3#wim5hhU&3{e$i)GDMEn4bF7T`qi"4AڦxUΙ&*qOkiiÓ J3B;@iLZ ب sMdWO9dYCk,gKonnmozE b2Q:Sc$2W 0rdBN9h1Jm$:|H<}M9#(4)ͭ핸BՄ>մd)ƂPgt}l!{Uy@BzHS4nˤ$=)gl\9)7yv`t!, ̶6ÎN:el ˻к2khʮ:XJ <'YUPCq5Wȩ_<a)H}_ jc;ͣ>T('ɗ.@m0i ځW,h 㴊'f< QT|~@3fqZiah{~ng!DT`{{k6bWX6SҒfjk<55eך kTTơkZl*W 8 ѱ_,@lp1jw8vu\OhtM *.C`}N(-7Ϙ3u#T3E' 4؂55*ȒM!cEx0L7tkxױb(Is̸1K ; >Ӧ r03TAQ Ԧrł0 tTr&ҀeN:7!\m+yNn%ҰYN-j8- ˛Yh 3Qx'EQ5RI A)2hi5ӘYe*Sy8e^TMN0$hƁyũUm5 Be \ Ag6#dPLyLb֙QIFGU`7HPOT6ã@36K'Q<:B9 mczW<ᖠ2!ڀhJ6s76:X<ߕcr`H; @hZA !!Vܼ`mELІq7lq:w&..4Ռj)qsS'tOhdZBrL6Ue1`3S N N0s?ؘzZ JG3fh 7{d5N^ne3Z:%G 4F&'g Yc H[eAtT@͏qc[\yAjB BVgy(m{aف ki-Lr gɢ@pDwuDL6DIɄB4ZBN?|,[YuL]0"GA6MωA\-qqai}:l;4:A4[; RV65A)5兀WLy@R1(bEKP6>aHd[8='4I"gnQ1Wk qf[h]Zh=Tm'8ͱ`K=LQy``";J5,F&DlTX&PG@\](.نz6ėg@}kgB]'x=ܮS&ssUjY&("3'@͐!{k$nMhp&-4'D-u I0iQ>/T5O \YٓFԘm[봞 /(0'q'H8(CʖNmsi֬k,5/uēcnA#Xy9xp`:'4Vz Zsq94,hP'_ EfkE{%WnB Ҍ N^ >:lq\gEu4%gSZ֒EAi{yz4rh6NAusB@Je4.aOy3[R&pL1/mAFI2M*ς lqɫY N C m*؂IТnnw,}i:QblHqmr|"=S= \s3:F˩Fug)u!i^"4 ڠY˵#K&g*;{S٬o%VR$i3s$h)iT{qpzM2<^l滄|'PGAo T=uyQopJT4n|Zx h@؜:[ZeE[YJsP_wlGO@)],"FZ%vQSQp4s%JrFɻ^iҶDҨ{zz oh#gͳ(q'y4;x1oؖ3Ktdq |K3lsS<3=m8[_mn!Є^:E"TGi< ݗm#Hhi'uM eFd-%36f P (1 r?b&Ip⴩gNU ЦLFM[[tJve&|.`ȅb2H3e^mj@qu"4` ܝq ~<.stpƱ<6A˨ӝ)$xjF6qÖ&ƬYݞ^*iVccK]3He[ Pަak;&hT6sT6Y[^BEe+mI]gFșQEӲ99锇1= ǀky,HR#HeVP̈V иs67J=q%M+wp=P\B4uV3*+z8i/ K܋J Z_SFUp]d[4fȣv:_m7t)Tت}f76$7 sgd5-%O'կUlWa2gd -%mR8u[ĺ/<s;iL:&ɩ"6 x06[r% 3y,E3(M 4TKUu\0.oݡJ&'+'p6PH(jo4Lh˥tL5T9VlN5(w^W[yUzsA㵏)zR] @fn ti_ &4ݑ^s}}9l*A`ib-*9: cPVs2Y9/0i)Y_eN_li50n놐mld,%٦А4QSRN'ޜBUl{|]5'L=;\v7 fu*=?c&'ˤjnڢLKr;խcxt|"dms] i6_9Op$r[׺M}eQF7Ɗг6(hõ]!/< ;o?n~pͮFrZ[a&ɬ_fR67 MwŷBB8K7۵ʆVAS+]=xgzn:;WirJʬgnied5Yɶ| MpFW[̪;FSGyiuBj|;v 7nR l{f֪u+:k{CMitxbMӨrS7c-X 4CFm_4ŗLV!lL9v|ts( (̮ Piu^;!r"F7TZnqnjY ?Nt=8S3 MZW~Μp<܂v>@+s|=(/'pw`wIi!h@.(Zuݜ:{]%j 69ʃ] t$mg2%s\[2)9Eb33۵4΢T4p9#!I+, !TK)>(D NM LU5kh(Ңٛ\3ۅfO h0'UTBm>ޕ](l& ig9k783ẗ̨aڛ:fWΘ~O)3T@:ݧ{Q{\J'h[1ň8SGql+t T7 z!MS"L<=$?JrtvciiBм"85<llK&ӊilqy)eg/"dЦEf]0}FCh3M{˽K>1(ةJH^DgkTB\a`5e4TlⰧso LjYiiVpՙQ&"85@x g>'{*p=6@M"j]9fjq`.k5]6ƦE>4m~sg$kOJ7+ k4UG*.S&4+33Wg]238;*v\mOP[m._|3@ϟ=\$O1= e=Zφ?va`*DYEhbfg3gWk'MyuBJs?g_x)9ۣlO-Y岬` hfr n^63C}h29ݙ.yYNtY=mgG;yRPΊ󛏁k)Z9SND?uY^Ya3}τ9- 7/9fKe|⥠06D̀ .x(L5dieR$iO6QS dQg"@ދJ %uMЦ{0˸LM10y,:k盎+ c kZ/_ 蕀3#ܞ=YM%+.bD|{54{[s'nDƩ5mLW:ڋ[!ͺ=vI 3srj[0Y=M/\qZ M2_LG$MnSqpH4*L-;vjk2Sm[ʃgDǃ0Fe_:&rU_4Ut5eUV5Maۋݥ^jhv4nksխƣknv e ԊsO^"U3VëOV}N 1J(iQ9LhvW\=e;vڟƺ ݗԛ^&\%Z(5clOֻ.6}Q3ڂ ;Sqvs 0{#Y~|Z:Q1)(GKh}#E#2謯u5 ] c0d[1^>ZLc{0sY]8n]}۴SCݜ(p+̮>|Zd/xtMP؟3\w)sn#FM)e'/UD S^T}Y89Z/9ݭ(?k63?ksI李z9/dhajۥEڜ˛bǣO^paz鑔u5U,;{ ?"z-O+-pmP6]{Qy'rJ:p*Wi DƤ ϝ2W|dy)8γWkU^lOA J13hv椹C#N"tZF>h+;*3޾}h% \zV )sZݾ}q͎vDΝ 6rZ_k*yO7 1~Q.XQƵ韏N\ u,~ dﻔP1/8DsYܾt9q[mIZksW@n>^1C1^ܶ{.8ov?Nӓ1YY&-,l Q7{x11 =%ѾĺE}v.3 Z&yx)= 1岳f죶#fP͈LdqM@{!(Jb^VSqL!ȓUl\~v{pOa{ |3&feWk,Cv$[ޕovfWBfoos9hn4%fY0xգ@CcJ1XsSfHfnUuE= '^3KyW_~{ |%&hc;+WM!3MuZ1驡`07W\\w3rt;&85f7zh?}L,#,(, +O23ΔUssݷ_}͏?ދ, aʐ2p-5UeOkL>9u=_\\XX_XZyϿ~|͏͓D4Xe WOG>ߚKGƒ֋>֕W3qq;}mdzyueeeuы|~o/>ZNF"H8f@BAZ[Wq &bi+ ͭol?|Oշ_ %%'b]@Xˎ _/~oǛtb*bQZx svښo\9{2fz&77o~O6f 0N%Sc#^Z[qOϙou7?o_??t!{eg1̴}vV`pշ/_~{hgceynkkOp6۲ݿo׿'/,&wZwSgOY7m*ꃖo[R֪ 6o0}ɹ{o$uV\ԘM3wΖ0Zm|<1 endstream endobj 97 0 obj << /Type /XObject /Subtype /Image /Filter [/FlateDecode /DCTDecode] /Width 619 /Height 159 /BitsPerComponent 8 /ColorSpace 16 0 R /SMask 96 0 R /Length 8035 /DecodeParms [null << /Quality 60 >>] >> stream xyw4\a( hA]t&ʌ(AQEm2z':>n D%Dֺo}^gu~{,\S\SRQ]㠧e!/&*/,$!$!)#$lyWiW217|@턈6=m)a)oh(ygBd&!T)1Ez$ `P|!y5Ȣp&^,J&:zyAyӡ1GsY.AW4-N0Yӎ2u<FѻC[3py R-<#k@l JTaT*|޳Gh*Y7]!n2_a*w8-&!WCA3!yxȹk#ü*]Ru_7^".o",X˦MKy4彝8u'upliEfAZz2=я?߽!l!F>;bhħ$P @īzuw*ʺ;ZJCp%>ɯOKvBkB_,l3}C  6W*L_O>5wjcpo3/1G{GKJݗIWY_фQ*jƜ#8YJ zɈCW#)6^7k<ϒYckF VzOH%kem1 \#,O|..}R2o48Cx0MN~3ל@ԤrKTUd GAsf-ϛ9q+'qLFj䤩T.6ucH S_6«\{Fk"שn"Ǜ?ƘV_wn oTkt;  }gqʓYI'S.;0{exLYubC.g*=!t+@:x|7V{ xoɂII.۟ EjwB+WnO)YgWmpCzݚ.zMߞ݀ls]aYFzܟ|NHc=h g[pq#@NAp7g4P ҔAt i;r?<&lrY%'xCLV&W(=Ch;6(ոZl7Oi5}xM^&fT( Kt}$T9Tjbw O,B}4n [qfzęacB7\{J^I~[2KKP63wc@K_VX0*̭Zַ6W[uhAϞ%.tA`>5qW5I;e#+NLwN5?jHuᵄҁs[hf"#(O5„mF4͈ cP8o([ܸ_¾:xr?ؐvQl".=:3-2AQz6C%(VFOG,M3o~ܞ>@еI U/奴:&G?A"ů15 fpߴ/ eNbt=R6s;㻧%K+= _s)y 2`(j 2P vekXS&WD@vWԲTg,ۢ}-#Zt[re#^ 8r,paH5w;)lTyJCb᥶6ـøfF*܇qSW /<&+6y[\#6Q hiDjiwxAZ͛Hci |XA5SDEu6ٗC2?S$&gPK"AihȺ~YU[#h}B|> gPWU5" v(H|,wdxfM("'O~;(G8NjTouSߺ _Oapf\mxc2+mg9Og(K̞ZxFGᕜӟݷ$sAc'7EUK-*m3f3&WꉲYw7:TDJy֦b8RlOJ[mȾs{ h9ðuVjz\z G ~W<]stT $fg%b{M e0YCCqY\=IYշnit 1zDPد䉁7Y^58N`D`"]j *^TXjjCAgaz`]N޲^/⟷})U+7AeN߉߮F O6BpuG?v O<48:KK'[ #i侐<q r1aICC肍9bG Xf`koQ"xDԬZ}B#'OUd!6u\6VRVʸ]ijo:L| SjV]wSN6^Bf;;ۺ=3N!K#`%ԑ5Jsp- ~ |^񮉇iyMa`9_1D~8n5aXEN~K!0Py@_./KZX" T*btK^,\TOC鉇m6YIOFsԦ\HpL4Ei;oΨZ:DW+᮷/2zLӭNEfcqsLspjk,1Ea5OLt4Ǵ\Ŀ!=RР>DQ'tXMQpWbq/1{oՙsc3g'<6j%i+kqBтPkcwj-FK$B[2 D؎)I ȑFX*\M9p6͌RP"roL7wKĐH y$>8<5=9J{ZI!YSu#? DY Wf潴]fon^/^P0LMupX(KKg]ك|^C:`Jy9^[=n9D;W_B#Vߚ'+ǣcڗ.GZJ83*$aV -( !mAePBO9"Tj]&'iU[D?bwh_kش(?^/'t^65Z}Y`d8=(V1؄0\FqǙD%ri׃Ne|sZ5}qĤY|4I"fDS z|ZlE"4ל4HF飤^x&fģ,ܴ"Hn'WDq8MnX V9VS^k<u5_*yaEUx=xuǏ?<)/ͦs@Vf2n%ePc2b]tajN-;}߯rK`n6; -mq?/w=|3Mɣ$Br26PE]/JE89XC\&秦~NwC\xVvYEzX暈 XW:Rb%9=o89)=AI#c)*^{zjQKsGs5]NNϰjf4#߆lSMB'rorms8Q >B}rFA j!?05ɸ/)LsthaQ!MZӼne@?Lr7=tW>m[:yih_?%x1(s#S GZ:|H 'l'腞LN+LT넃͏:0#=z5ܬcyOJkP|dȿGnȱ6ӈ~LdT1IϸæBϰ P ,ҫy3wrǙ,>譈řLnS0R A55snT %%5cH q-acCRANq?WrE⺬3hUkXRE{c%Y6&$>Sb 8TT= ⴶKs*$c|q>Ek'Sݨ D%W@ҙ ]OuU.GGxWYoކx(gcٮO{UYdlZio %>yxxXEwp ]AqBzxkJlydJ4e*H-s[d,t |])>Ccv_mD BCfDSW8N4$pثbɺ nt+0x nǭ/ex+KD[ ~dg|=eUAM+4ϋy8hv=oN(dePqCLź;s #w 7 /x 6]WRz.X4oFܼ]u-$W-z\#α!-"warŻɺp"#\`щMA*/-֧̱uZB(YT3{ fGEsVx>WN_҃kh\%,PO݅KpKI I6'-#S[B\7+~ _1+ rZ3 endstream endobj 47 0 obj << /Filter /FlateDecode /Length 10359 >> stream x}M%nBҶWËsσ`xC^6 UBIQ$ESz?_~_]˟ןz}͞ޣ~uW}#p,CD_-s?=? ?T߹b_Yǫn@5ޫ>? g詽̯TkίnUR}jҭ?fZTmAO׻W~˖Z5}bB;/Ȩe(;jӚ47ѼW4/=s.|/kiy3ߍ kzkt޹ztԚ6Ǻu%]+LT4Vt]kyV (^|tEa=\ޣ6^:+s0,b2_--ҳKi%GQr}e[啒Jɔ U5IMs#dlz~0 }tO_/%V蝘/OLoF0+XU=al M\Qg__ØX&Xذ SMhŸf| Wi0wlPs |];3M +Zp_6lHۧ5:d4[-c^놭,.K#b [6+1j/m@! 88ej=nG`2wu`pJ’JUorFqI]:keYy>mXgk붝oZh%8Ceaj.Vv=7$l[aLC-tvQ "@ (YXmQ =Let\\, 6pI&IŦMFHlr$l{F> @ Ֆh[ͦT7v)5%F >X4M-0_gZϓ/"6]o['t岤&7Ko6dCbL6nM7 M)9a;qw U^f|( a-1S!h6JڥrVvN`5}. lR8M$f z?K`;DR@%MKhS0Y- CÍhb a"HTOf%6%hJo!V u' dWDElݧ0lg)6b=nLfnۤ˗=`& zM^?g1᭣6a~h"fi[p"49G1(|i60fvƀI|d52z> Qtג^! _q᫸`aUygc0:[ȾxA5Bw O9.אO's4ՒL7&I$U!io:j~7bVua1 ugBq1+iƬ+`S&9kcbt;,,1 G(10R4ZH\:kMgf$qd͂eٞz ~ʓ [&H͇h!f%Ar30o8[+[\Sա,~LB lf{1nŎ;0ΑtLTh>4㄁?Ku0 cZp7mr{0>1fTAk;E"Y*jY(cȞdT>V #y$s`S6$Iͅz|#F+Y%W>+hW6%R_m/LiG7Cӷ.m9Hzb/p2#l_k[?_/̡ Dzp .SmLMNa9/m|%*`wB0L^05ݼ pNe;!n1܀] *pƪƭW `t[|RtP`- [}+ @JB.*EO'Uz8f!0v)#ox`ܪOG[0s ӝs<#{@nG(>'TXiU#"tXj#I8\ơ2 GCE?`P{lLa c5ONp$g uˀaZDztFPƄn[:?0-(3cl"RqL2DCd@l0HƅIZnu1^Yp6(hQeQ!h| Ňqx&+3Z,9\6=hUa!/HˊssSnC)NL7uaf6<~X 7۸7p>m`e=BtܴO}ˏ(6ٱoξ)3a[Vujr6@ mbov309F:{5.{yO.<%}ޣ=ONX jQMR ԫ{J%w;pVfn^RpD{nT"i o'`'rJ0i"r?w,X!.Ybe/t,|[%Z'KmYatC~$3C"U'S"MO$=:ԃzdܫfD5 f@ m^!WYW0 l=;PaT)rpKZ}(=ñnFk/Ѿ'.W/ʁ)dHED8eW觢Y,jRڜwqc M`B\{[S0 'YuWmRu4^ Abƻ{%iƫt5.MԦ/nn3"bK=Ieauuk\אҙ}`-&cɉ18~ lO=L\geF$}`:1Yvc@z?01xz{ĉmkJ +ftNSDNSx>"`vN):0t0ĺS(AѷSd`)SnW9 WeX)) WSXrIt'LK!I1 4D"8 o~_+~,&^7EE 4$*LlZY?V8W5Y#ݧR&wwx.]_:;9N D>HEqȡv?/.kUOBbx) Y.;HDY"kXp!o_z^5BBoiO/>¤xa[&C0{bֻ~t߾)o kr<_j{nDϷ=f5c'"┟fJ!CN.Y6ɉt zYc܅7;mp}ad2]L#mpKB79 |XCܥޛX!=|-oq _@P틂 q.Nb#Z' Oĺ bFK\ (MxMF );1p:J JC7CԩpUw~qS/ibzJxJ'Gj[y1t?{[ˤ;hnp;Z k;P-Cp$+h^15q|A(j^{)ךQ2F2Liș<ʃeofYrȹEQLE[B97x2;9Z(#_stT [|Y E[ 0LqL󈮃a2ޠx`۞yw0tC4̔`.b`b&Ws⪏6,蒥FP;t Cࠔ9wU90 YpQV|18)JIChuUѠ@B7ʍQ|3Ph!'EUŏ Aܓz=*hL$#6Hi6@q‰BjrgsK8 6-Hh~0$G hcv|Α<+cS1 &ءbϘCp<ki5ƯN75T1'ś0N7$S|h I7z~*SYf W_ {|-6߳|n@w #``P[>?gcYy)w 36EWt_OE^_?0 &1EK/LNjxxѿ1zw?=h|O`hxbC0N?#iƃ9p1RJq{aw]')`+v<ۡG q`ʋw(A>@Mt|X0ȝ@+&j%Zլ̽8|rNKPM?4Wi!ẕW_R+8w\ŧHT쎹[,d2b[6-:A)͙'xY<}b E((W>s<ėCøƝCKx Ź2LYw5]+4EF{tJs=TZYSX)'aKy+DjӲt/P%o #Wq5 z15O r&cp~ߚ10<;}BbͯӎxO;>aRGFy1(H@+3v;fc܎|2Ucv Jtl6Ybu1gm=혉gk13!}a#!6ʐA!sMnmwg 7d eahp\dꤌ1NCA^!2&4dP 2 )M0dlb?! >mȠU!0dN |2d@vWYLpJ`=áP%  mlZ! cG8D& äPѾi:|C3N Cws1E&Opbw'\V98v*T 8W"\׍|^Cn&ߗгwM{qirW֑|Ktf3?7=qwZZT,1G;(5D90YK(SP>0Ө?>i/1ERث|_\Q,ؿ7@Z]m H]p՟3H˩ef)2 oZs S:zц=Cy21?6! {m mOکÿTBbDeV>@p7b66#L&{hU?'_)heVbfmCd!iǝG5D貅.$maW^ nzd76ZK@%eL"C$!C-]^Wl#<|㪲wȴ0b3%G8+o.O 4 :.WS~H!.Vy\Uq 鍣H>*@~"JpK;ܰ4<RvP;l_uLa~ ;c)u4S`(ze>VH2Z;\e'5LguԠpA-bRMN0u\p(0\fޫ|= wG,j.qQv֢5ÛICQF:D:!y/†Yȧ|cҁW&Ƹ "":*kv+I r݂}0Yfl 4K4݀!݀Dqɲp˔dk(=a0 q_fQ, #֒ 6QމSU^V8EKvt2uؠԍܼMw#jg/ܑa #t6"}!ZF$_oǍR{!y-N ([/J R=\hCnP6䉀 r))7VmH\Y=lH^ qm}m#?0^sHtї3(P̵p'fï" *Vc^2" &åʟөߋWcpa&cafaQc`aI`,^J%V}=9l,RAzO;-A+lbolch&fM䫳JE}E{>B ژ}`A$ٜ56\<4ڸX0W'èM]0LRp*jy_rt9[$¨ǥowrN+jND+O/x[A"w#I|.IyQ'lΦ %ыb`_Sh=tJ %zg7s7ܙx(N _]bK2fJ1YTën*q"/↴U$mDKQ#mzg/ƣ Ra܄a1XdIX Xf"'/6'fRqNULѕCDi&˾H'Wh+k\qHKpLXv_뢲#K1M^9HazF$xw-h/\5j<[F1ao?).Ën=b ᩬ#$|(۫(?QՖl}cF^(RWߏT^^冾Yҥ*(~;e/3S̨dt/Kb/,QVv^K=xQ٠Ldق9M~Rr@Fe6`)B>ԼbR}Kg?YC$Ge-);⮝tUL֡'lx$fFGVpнjنLfZ'`F1w GLq'8\YL5ύ9u|`\ێ NV3I^E3˄fsur3K3鱈rSh1Z> uE)x@D pa ]J2b}1c}`#kN\+h(BH7S.&R6Rܰ`%#9MЃfC|Tx$Q *|Ͱ0yC-!=IE.i{%ҋ(j"guF(F,0/HgI/z1aˀ&KzSz1G"jȉXzP/DXA+"(fɑ _4X endstream endobj 5 0 obj << /Type /Page /CropBox [0 0 600.912 861.768] /MediaBox [0 0 600.912 861.768] /Resources << /ExtGState << /GS11 12 0 R /GS52 49 0 R /GS53 52 0 R /GS64 67 0 R /GS69 76 0 R >> /Properties << /Pr49 48 0 R >> /ColorSpace << /CS16 16 0 R >> /XObject << /X3 55 0 R /X4 58 0 R /X5 62 0 R /X6 66 0 R /X7 71 0 R /X8 75 0 R /X9 79 0 R /X10 82 0 R /X11 88 0 R /X12 94 0 R /X13 97 0 R >> >> /Contents 47 0 R /TrimBox [0 0 600.912 861.768] /Group << /CS 16 0 R /S /Transparency >> /Parent 2 0 R >> endobj 99 0 obj << /Type /OCG /Name >> endobj 102 0 obj << /Filter [/FlateDecode] /Type /XObject /Subtype /Form /Resources << /ProcSet [/PDF /ImageC] /ColorSpace << /DefaultRGB 16 0 R /CS16 16 0 R >> >> /FormType 1 /Group << /Type /Group /S /Transparency /CS /DeviceRGB >> /BBox [-86.3456 497.943 605.468 916.188] /Matrix [1 0 0 1 0 0] /Length 784 >> stream xڍ{,apf5kc;z4AH:r ܒ$I I.%c1"D!w=NϾ{<{Ũt DkŤ+P,6Ǩ\d?PZ8\cLba8bqPI"2k&t6(\&c/}hOOO8666:addлޞΎ֖MMMo_־zYYYYQQ񢼼yIIqqqQQѳ‚O@NNc%IfVV&xTI~{ !!.$66N,%#GH}DEE@DDM~]@HHU|wD"_MpnnnP(\\]]8999{`gggk{@ 8lll΂3V48OSS3󍌍x> endobj 100 0 obj << /Type /ExtGState /SMask 101 0 R /AIS false /ca 1 /CA 1 /BM /Normal >> endobj 103 0 obj << /Type /ExtGState /SMask /None /AIS false /ca 1 /CA 1 /BM /Normal >> endobj 105 0 obj << /Type /XObject /Subtype /Image /Name /Im38 /Filter [/FlateDecode] /Width 1136 /Height 561 /BitsPerComponent 8 /ColorSpace /DeviceGray /Decode [0 1] /Length 59480 >> stream x}*hi m{܅xI7 1S)Sי{vrg#~'u߯|k?W"|2*_]@oOO==]7'7=wqd6|+C| fMOW-X'>rz{!qd`oM.'qz۾YH>tvvzMoO- J88tB o:qzT}v|kh'QQ+pIz w}.+ߴw1|emrM'q5k1\FikgT}7E\&آ*$N{.*.ߴ+tU}_0m"qposLMב/?ᛶc꾊 7--jʿi\ JNqd/8Mw~+148džқ?7J88>Xkѩ7pmQ ܊$.Ai&#%U[#.NW2M8p MMJ8-IXl;m[@uNi Y:n댛[Y4Fc998θƽ_ o#i]xJmO5U_W=wM83ڮ*!`N_ᛦQeNUjk\1oTX 1+;Ux |ti?7~g\'K|SC}}}rT)oFUo-7C0NcCCc8oqxn<$oXQ@xEUGx0Ffq+P|#1.qW8aW8|hiq?oHα mf|'ƍ<Ɖ {Yގr詼7 KSW w&μMU8 n6qo 7Uх** 7ڽpcO 0t '^Tyǘ8$C8]7b 78+ظL{7g]8!Z6/ب(qxpݣ"⛔V8ɗ8J9L9T|0sNuu 捽f/l=Jm7TTU*6:x89!X˽pQ^^Q',NRD5'8ӿA(.tzrJv6eڸ18l M74t.Q66|盄S_ጝqjJfVUwbk$Tg]Q]58p]<&q9^] U8 $N yƽ5Yx;pejo6mڨTϪഊdw۸ #߄ GG'SSNqKpwת"Ʃ3Xqop*܊8i#a\_iHa]'(T>N,!&`TiTUL:VUs<p6S-dbȩq3rMqickUU 7D8%p27T޸G8v'pbi˹p Q)Ҥĩ N7eU}7^oO)Xoc5SU8k0e<9ШM~#q\Nwݷ'׾)qS9i:QNv:v1ک*R9]e_,߈Ɖ58`r27Iv)C97oqV9P'c)NotVNs8sUuv㑍[0&D(vEUiiq\cAko"8)*WVAYߩ &46p:1"N\c|3U8N YN]q1rZ,N[JY1q (%ʱ?k*q*rbUU֜q !}0Nql_oN):jhWU9&[\q*qW7`)(Ԓ0.pb5UɁ r4<^[lim׬rUgkoHuUqpx'o 9g&q6-ޖa'.qc.8F^WW{W3 )) b*R OK9iwEvq쑼a՚p5%)m7FUe|*A8q rӢ6NG*t5~릛Cop }Qy87w8Cҩ.'qmN.:o<℣uU5^8@9(߄뜞UggװW1Xq}*+rb}0k4,Nu\lo\YO *z(g1Wc'>)jj*Ҹp[HDNG-6&81GT+Unؘ\㤍9v.Ncq\lmqٚ%H&WǗ7Yɘ2_)DN8ގi XۜJ9-Y7r \m|xʍҲxzר 8-[T3$Vͪ`!T9M߾Yp5ꛀo8Er!b**Ὺ8`cCcH& /n0\e|TF;,p\>@zuXUIWeDmWi WVXNgg]'Pdn!EUB8ȩu*p9I)[[Q} 1U7yƸߥ*td*$?Kj܎c窨gǭq/ǜqGױUWO=%kB8~i<8^^TŧXuǩOPN^+[UWD8Np8:^O!7"!-HJH[n?L‘K7 2/o4 $MPqѣi>N?hI[n?N A8F/)N8e>せ  ʉNV1e%﫨799>ߤ8)q@AaUS{UriUƬ8p%MoSjUqQO)jʱi`֐rt}֪*✼ F"r“㉱cbjJiK3;y#V \7>d ]z-x1‰QN]'qR}w9hb2_T(."^Ci,ToUe"/ت]ȃ=nK7!f8.e ݫqK8D8n8\̜紜V+o<'iSrqS)5UūSE؀pw9'EZ +9Vx.NSUO5qGS't|',<~U}4*5>ZpoJ奮y8xY&©BsL|S[VVeʱQ9V㴔y@VvqI8ɕ7^2@QLa/ vUIhtN^j-p 8ى*No\X䯍iDWH8~`U"]:i)qs; Rtg0W0d8i*?&*A9{~(&vS{-7}?kFYW9쿂v2$&],We7)dpؐ4%/Xi.*|2Nd &~/9@;F8rA:q%/m**qso4݊y/qt 'I8yi q|S'ʔU)u0qCIөӒwU7F%N:OaǕ8;y5 qtN]lqk[S`0hР߸*7SqFI.MY9n9uuIkM̑͡)AU&$'Xs 'YcbnY'Uҭ/$3rliCsһ-^gKkK-OoR9i5)3i펗dNz )XtKus2f,)VU7,p.ҍ k$J砡zA&u99ue`l1tUXp;|M6N,qWSyGc|)*N)\]eT7v\Fau)Mr/ЍNSz;VM~)Nvٿp8?h!VS)@ GS; S|wȽQrcm8E˛؆C7A9cͬH Q9y}C4pcMw~P'&U͘Qo(9Ӽ˜ԯ sjׁ[O }]56Uh\NħS9=XQ$VIg/ɠ:'$I7*b;/81/´*0XNəΆL'qJns tWeq}*rIaWѢ4NY  oT32iU~eS!kVܴEX4y>b젪NUFj‚KdR˓1iCGrЊtcSsWnP\O@I:YAYg(' "傌w0eUUU<&ZZ(oh)fK81J72NUY#!5I©#yXx>sjC]gr7 #W񒌓) W/NªeUMtb$)?iT \oHJaԣx1cTSr<6y;Uv\.IoY⪹_` NwW}^VVbʟq'xOX>;jOVy8Ԥc=6kݍg|Щe*|gSTuGl,r4**q8u&'u38Ar3']qi~jN<04K67jJ,7]]]ME>d R:t3;֪s(HVUFXJ9UM[9)#Ӏ Yo"y8}}k+"79)eU*cFN]׭J7+AB,-rjW%֭Ҝd^oH/Ç3ʑF)cD{ec׷;+sh/LNrB6ss0E.nd}>4ƌ3zԨ#1pP7ÄӫTc{ +e8F:TWǃ2t3s(ЋsNawij(s:cƌ1ND9ʡ'ZqNx N^Rv 贗س1GVVlq_U{1i.nj{*8U}opj ]QE݊tuƏO3&ѣu328èi5LƏiЭ=U"GVWuv}_XV\1ISt9!zgeLeUb<1rcԨRij, 300&`8Q3r +LdOޚ1iDZ;32Et,89Ay8hZU:'ɜzZl`innn qp"7pǣnj6Z@aZ` FVO'Ӕr qr29ÜOWOX:2ѳi+,t#Lc2sN8x\^WL%u-pn?mc/盶oxôL<^C9FL U3?GHGxǬ@Zk(rk " ya`!4]Xv.r=+C Tjkooo*FdiSM:uJș9gG֑A*FtW[aw|('9s)3'pKeڃ_ew`zU8D|1NGk׿yU@>-Bq13q/BG2ǸL)"';ZFqrRTNnh$3tq!rR;VŎXjUTV NM3Ttvv6d7SVE|3mȱ㓏08`/w2kxS[rȺK [mBJd?kTv8خ ͆zK]q8]zg033L 2c@_!+ǔVۘQ8CgԈ^Ux8'q cH/1J7:ҊC^ {Oś|Y[`=fΜ1c3"މʪb'g$LHgDqu 2chѓ˩5Qc(gJ;u"so2/5})0'Ý<(""BJqǚ6ئ8uLAT]]]=ͅ_&<fΘq8FL6*ǔU: 8q$Sj|л2<|UW&#-t)t.TyթT pzzz:*flW5ɘ1}9Sb3^(k!ΕN#K%Cv ˵F4{UN""N8E㏉uC)]z( r+c{EpQA%sƭRPu!m,fr͊0sV#1f&ݴDZWV;c#%^zN^UIkZ%"Hi 9!/,J[JH~g,S:AFk.;gL-6f.8}:+s7\|s} fƙAEΔ)#+M])W3|@k~S1 AzvZ"$/H''})@9%Yb[Um7XߓI4ޤ|Ӣ-qlC<\^~Tʙp SiqfذDNt8>HW_dqC 6bm_/3{6)YrCn it&+IҾ0>lcĠ K׿1iZU""'}؊T2l=~)D;:Sa* 7i>؂Swfuo| /̍`9hgL%Ι:Tej I7D7'Ll$_D<,+;{(8^qA UNQ` t)K$<UWeq㛮A4g#GtVeM'<0/œqO/~MJaC3dZg2p- VWᵹ*'^SC{¥0פ?5cN-L3 39'!p`"ʙK2gr)Bg:U"&Jbe2 $ s[ۤPqㆷV|".h=Ρ*7lJ\^":\]G- ϔ)N(3"?hO}X{;+=+ꌭtI [䞩c/b)]>x#r̪)R5]z8pxO\oDߐnfqGvfqkK,^xEF7sˉ&ptu5v"31\i>G5hVUƀ._iٜL1] 'pK&sh[{GPҟb!!}obl钥K,aT3[9ˇ%r3m k󈻬 B2jTMR2·ɋ98y3NgQjdNI,쟸a81CUk!Q1frDcnM<a4Ow,D3_gX73'?q3)t;o.ciGvo2LfY򠹤ɓt䑝 ܊%p͊˗/]iEQeR윹s#QB~₋HG6Pf0 $VID3ө#̵ٽE1d8)<~K^l)sì SEMUtj&OosNTFRNQ U5+V0gŊEY@=L<<|s%̛-#+L'D,5oΞeX}6<;A9~pE'e҂+b gm)9~QUSa%Os8 ^oTo%xUsӗ9ZAlyTS1,D m]dIz~;3f;6#X>wزϞ=!7p2.r^^^<8nd"],IdEwJx*;d,#7RPᛩ7oC߬ZP8L]INT]_@6bꐱc>xc|c}`ӭt^k=ɜql<fQXK,*'94FyX5ǘW6 7TO ̙{y_)^zꕆpe ss!CkL=ame*d\>Eخ:昿iN6ӟVRX4LPr~*StE ᔥTi&Hv-L1C3gΞ}C{V߂(p`5kVFY9V,jb_-ς2,f! b;nH>bW}d(*M=!/+?qJk 4F_*lʋp|Stvf88vcsh 7DFt ֯_QJw.]EcmE96yT!_|se\<.#ùsu3N "vMq XFtȊgvy48K{O\n5,} b͝6vxkrk"[qjSY$/TWnz˘wjBb3H8μ9sxs=D͵ C4h%y]ysFW'}Lcȹ`{*̩EB<űxTMzpoYEP6pFEFTNV'RsID娨lܰq V\e V ,W1ŕaBa`01>T9Z0f,*Ӹ+A4 +; 9r/EI4͍}\Kጕ)Mq4sm֟8dph:雡o̷o!eξw;tr<a$r"!zy*,XKL^L֢D9Fq7M!uY04gd ͷwfvIJMB.Lq)RiMeE ѭ͖8=}7Hߌ;v1p"2uo=`"Qp_ѿƍDX&3jg*n+N^ʎ; U E曇 7?`P|!c{;?e7!o@v\S R= &"ǢxT|P] c[Ozj7KoVZbZ ,pM?3NrGUպk׭_O1/ZfA霅j ,,s,N,05PD:3z 8^*77S&O _v\1;'Q 7HIBfT7͊'fy3nN6U͛7!#gуˆ,wtsn/ZfsXKM%~SvZA,vm1CFs'lr1ςIMywI8q@]|pkV^)]*wbN8<Ӥ}c *7S9PA`A7k DW-s \UعsmFl1Zlr'yF dg;D9˅4Ғj iŬ?2kZ͡ņsfdQQ:Y|̼NkUg"ͥ.3֤?'p"0 c *f77mX`QF'p`]vACcTft 吅̆u<$(U1v8"bYiAzxx /џY>Y"V p;3^$O͐L`D[x8NmТ҂*4inC Yj 8o#a4߀1p`=w޹k玈tvn7gvs_NS7Zw֚"kumWf{YzIxֵzx'},VRae!qz-WXV9زMJ"iz7]vJ 2"0l[0 gfst(̈́1mP-axG?pݼn* _\|N8!4j(g[$tU7 l0z:򼠚C2c(F@wv"ՖV\vyq59Y9Yrd |")0­RyG3)x-oFڈ?AE1o4DFg- 76o6^֭.[4wd_Óo{vy"1Z|d`1=bM}Hs%7GHLkqxpXSOdK<+RU1fݸ)6jI)8N;TfC͕M囙*8"g= ~vpXD{ V^t36+#:d>NuXa8zVK=2#v2WZ*o7<;bS?k1#샎62 qmwv{uxy咉uL|YG.r5khXinyL9gU#FcJ5A8XTzl7Khj#U Kڹeݚ3d)\A8unjԉH8:1rg:I6%n1y#cIw"yu}|fa d 7[K\NvFaG'7B9a=)pkm x\RU' *Ec 1v9rfK.],Q}8k(gڕzƓbSN#21tLyEVc..PeN8{ۿwWKg +3gNGxT51#s '#n_=GHgnr2h6יx۶mbmffm঍k5'gu39Ӏ8؊aeuʴ Q8|Ώ](p2֭Mba|o?طs A<) sH=CJ':'O:æ1Q<9 w@imdf+ZTM,懶>[(x׶6TI$WK'0đضTTxbǕT/S]]!\jcC)8Vc-qZ1T;#|-G _xq%s99-+;NE:i"=H9-P*vH̳{.U>D:"uy~l!YYxr1nYvstN<i#wN?*3GYKYYD?$;-P#ztA/C>yz~7%"og+o&ޕEL cgŅqD,ppc>Y\J2Ie[v'86b4I 'p!*8k)n,?3vk҇wl0uh>q{3td8P:X'rQ:ʤCAf'=-LU-3\Nu#zgZ;n-i6&=9=8i8ߤ,tz[STXzee^Vĭ07]8o7NK kuosgK*]:û=lX(6 yǟxXtLt<ɓ::1sܔ\G%Ã\s1L/$wXgn[Lٺ!s9;[x!%֊ َW\%H1ǵ:V&KVþxYM2x+󠮘Y>&''GrK9 FGoQ0*cvp 8Tap:f s(GIE|cSJf/BC7o ڷk۪)M_/ҋ`4γ\]K'zc ,:lc繑uNвS{Nys8[ǬޡR.:p"tIT4 nHY.K'*lu~UY89cWRT6\QIE%[J%>mLY(aL[MƠ1C?O;#87K^$c8'x:z#cZ;y 1[T83|̯$B2wDЎQݝP2l^ :::^%*MA:ViA0NVT`kRS 1)Ov^VTpSpU*pC\b. |NFy Z9ގ2 PLAAOӠlX]Oj\mVfLgմJg`RǍ2KU88cp-q[Tr>[Q-Q󌩢AIog a~Gݵrj/vՈr^yjru1\^=匝'\eJ \dwΞ6Oۨ/˥CCSPFtw\X˽C: )ʈpR9,c3|߷&K,UT8xp>}n58kղi7[@c4dY8d9E#l:ˍ70s"8Qc,:wQ%#O̎ێ|a[g1B OXiYl9eҧ.^[^7̼uJW9TQQG69lIS<ʘ6t7q_7S[8qEM%KpVY GMc7)oioR 'cуO{{7 t^>ភڡϻ\eQ'4Q~0S+.w.jzЁFb|oaW:Fl>^z,5ֳBjXcr<2|?Iv2/jƹK28b;^%+MIߴ|LENu*ͩ'⚼U|&ީC8rL$TḊ猍Y\p@.o9=,nMSX 7frQ,F>y 2.~maqߍh^5oTaK9b' s)fq']g@@<=g{2s&t;Cxc:i;9bJK)@ 47=0\%9x{U.j*.d*.p!VQi֐a:$Ykp6\CpVQc4Rr^ѢJF**S`1|s,:vxۼј>.[o}ϼE_yM;dPWY8!y򎨝gu032cFx܋]{[\vkq/4z;w/>JYz[Y,v35o{֑@FdZض!_䐡Ք@aɽH0hW zjjlƮ5L`xרpi̻n[| RG5Hˆƨ?؅gO۵`TE^/?? a|+uu\dllW_Nd/ ‡ghn,4 ;)ܬT-Ն]mjˢʕq /l"ZQ8iG-bԩgg|#rjY)ۛeذSlw5y]Mkj+7ēO<~` ;;O 1Q;"Cvia.WX{Y{\jY}~!Ͽw6{k~'tNI-c^2O騧#jK6+E;5t;BKLc]ϵm<=P&8L8 iPOO±)yB8lIe gw*=pl<$RUu93j=cin/Hj[2yDǻ{̶L ᬰ J28Ǩﲧ]!M8Y. g}M /!#?39$t"IG;[z{ |Wj-=2Lo+T zY%C6.iWU= .? G!h \Gs7ǾSC/9Ixq3m,{nsL0pd*4Y-%Sa㽼/3>ᜲ5/<q{wU|Xs¿ 1ZԎeHXC2:osΛ*xDy⫯*dp7ѩ[OjʏS,e q:+?a򻼛1a~/#qЫWOMDDuI P/ ,9F(βp920sxH8ɦG"2 N>iw r+h8_SfW{T\RUTԟwJ M**S *'LtQ(>T3HY=96NP:/j)V|4yR~NбYrSv<|)2GR>(/^aiJ5pZooYzTQѽ%{EiLs5c\c۠C}*ݧ5LmNqMz7k,5ɠKez;QIEkg 7 I1Xh g?{fw[!ճL8 pO_:}:!~3їt2,wdrPݑzwuCyw#-v޴; Zdجt:tbosq% :͡CK'K{r|8H.Ȓ: e;ݵlT[qG'!k4[8#,ؓT, G3FqN7v*lDžp=#z+ƭp˛g$΅'aظ8/ګ/X֋W{e5:5QOD>uxTǢyӠNYF%"xL\Yu.L~ɟIYdQÜ(3r]+lYņ"=Yf-J>X8m6/R8C&Uɓ$p͝g%΢`o%٘;ֆqGo(PcSsTOzqqLM"3Ϋ4ڋ+gH"R;"xp"XD;?r-;=rv `BĴth(P/P^˲¬sȞZ:d#3*Yc*65X\mf-uhqo:+N:O>%}ghLq^nŗO,E2|??Xv~%;=3Siek/pKb*{Y[GutSi%݂瞑v %K:b4mT9:6 _P ,"Iaw$&a‘Q=V]qpqh,-"r9k86IctI±.;C \pIesqh G.^|Y9(GUzSQ{ӳO >jָSqMʫ2Ru/]0n^o_ɼ'" e[`EexGd)ܴ6΢Ǩҙenhqŋ44#c٭,_$ːt0g͙r81od Y<ՉcL;JS+GszvuLKvG^oHU#]pdG)-"YޤFm$ȡθ=@6ND8nA?8{]Ҩ}*iTy8ZT XPٓ b_F8'"ɿDIbki)󂿠ֲG=V9: Ҽ \rx\9W4˻e.Rn"YuRjK q{nOup ^I87w:::ņpJ hU Ks186gTFVUpe^ēIߔm*>aȣ8OQHSa䒘óTewFՕWl839Z"w2߸aAdrnGY?md鼠8T`I<8V-:RYim0^:oqYp4i>a[bФ;GunaV_9sѐNHMqo6\[|pLьYAo|8&Ln߮7l w8r>t8H?&cؒE~W9^ C;ٰ. uhaQ&SUYRK\)̡b|!S+UX[HνHA1u,ҡgK/kN"ۅ+=Cþj&1GFI#ALtR8/8{~_3 n;K닏3fcK8Ӧ͐dEV2q8k3¡#qFNTW1 $ FfՋŋMx!^'!O;x֟y'jdѕk-fq%Zx=,oh dߋxC4_3+bgl=a2Þ='[ҜuQy}XMb޷ldM1_ Zfc20Nmo?UrololqwhSw8WuěqTILFN6KRDz霋qxs[6x= Oӕ_bmg89x/OQQŶ11\q/YB|ӎCrFή]t2F6x{lYyL48 ^26V/LkL91ґmZoQõU>pj'WeDR×X~ ÝES}Ek7۷ l G{+BT;Tc#n@tsڵ #-f;A,UM|N'V UP_; ٵB#GbMSaNeڇ΋w]GGC>—p6f-8 8No|1h|qȫx8?}ǜc&q^gW^E8SM8b8mՂa11pv\?^0MO$hrPlzG&Ytfs❾bV5,ұO^T:^l &Ef!IؙxJAfΐ)YG i}کIJ,0rV:2R7wuA` .Ɯ|.žViy؃GgbLPBG~>~ŝWȌdJ;OfR 5|>X՗21ᛪoۗ80NFBj9P=qqܔ6/9c41c:ʉ NvD9X񈼐RQ/oW_cn=TI#svMMt6'(x4tZ>PݽytSP<۱a}9fW`BͯT%;*ke[Y4C/ 2 I*\8vYpƅ7殊LhSE# mLI8(rUqKdGv'tUVLꊜ>JMGx "'%Nq\VgpppGrIpGGYovbl)dahFKԩW"Yꜚ}6l{S+ ޓUqD"o K4`W xte٨wbgʓŏqq'`Gr#PiL,c7 q>T}Y$^\!T sqGU8(r%aO<,q4 +:Ǥ-dTժj3w>;V| ֗,]rI~syO\.ghhð#c͕aW[p&[Kh!+ 2Ylx&"dq͕_4; 쉼̶ btw.3e Pfv#XcqӧGB{ X,Ad(q?QE%Np`Ѡ*p< HGpĭ♧EÂc=6c٪R gqlkq ύ)J@AsxH)f<9]VΝCC9:hIZ,̯Be@Y_uKF{B$ҴM}\_w~))Q}r`Nc(tXnjEW"ۙ_3y[;䱣O|+AibbmT]i U_8nAprG!Q T!mhm#/_9+APNjufſthE3OoA3"6%xْhoעVvXU5Wf(q0~9cBV QA2OA'?2Y<+g6&4[f2!0°c`1Ny_O+JշPhd888.&~?zD1Bt-kW"YVXp 5"~\sf>^@Wr rV0~+>g׮ )rv NLٮz!wO6rFNWWwt̺Lv..^5V Xd -"șB-sL:], ey3Pde}0QA7sڔ~K\lXIKjxNeM8@q;a1 d H\ª,o*gLo+s_aŐCCxÅ9U:Fx^k9j1; ,lIlu N[t|SWkSSg!Jg 2VW" :KYDd-sn5BP'\kzf.Nqƿ`)7U_fG8_C/k 7>T| 8?h:]Jrq|y\Qconx0 "IG; `>Li_9ZI zYj]q:g(|18i@`}V_{ Z餘dZ2"J K[UEvVyXnn ZîD@8رJGBX-e~} YY6 g4Nz*lp m#ro^M \xoc^qஊ?b昋^sPٱQ9?1@f;~FK ˯8+{hAXSM4홉_3| _Ku p58Qq 9?$eQ98WX7)CIp8bt,Ӫ@;c'r\oec90P8+W*-_7W._-QQٵSvEcxX 1юS -hQkEp:jxdsC@ {L*2쬉(dU" dbyjWK(0C ւh=*&)sі>~'j89_"8_Bw_Xqsq،PfslUY+{ (9HWe}WrƊ9"! 0uNr V!0'AR;zg~urv6!eFku&  M6E';NJL͹ݢ/z66i0V TS Q3 tX(ۂ8Ee P M"Yn7TBbΛit5ft6{_—YuUq{q{Teq qtTνi"'` BF {B9U mSdfiZu̬AJRՅ|WW._)*'T:Q!dO=vΖ2αdX"J|𧮗KgC}diAe=#Vx2֬9)[tV;%KfF){谖';.j)$Y`$ddG+R 96#Y'N8oi-? nB~Oh{Q[d/(_1oQ2Z+@4o^|HBBġt(lݕ&AJN9NJjǀ']`ysP#2?X~vY1E^N}{WQ2U<9eG!ZKX˭hQ -WؙJf$x}4i>|xVG1ɹZ۪"FMEKD3)ǁȑ<`,mj9%K#&é">~hj@4\;uh0ڹL ,JU8ɯrMٲ{W._j` _I} NM?on'vbŬ`-UHu6Ur)I#׹̫j '5 JKKKCN1;XV%TϬnV΀Ur9:־qtEVIfߖ*G>UN˛m>DeAp A98+0_)CkKMxyerF0G+BE_  ?s x.Ke;[]EĔN;:NIv4`tDX[2ͩʡjy"kfqE^tӜ;X02ݎ\V.dÝeaCK\$>2^|KnчON8f 09a{shH>QrAG3uulUWݱ[kt!9B3N HcjwL'<\ȑj5AN9!Nu_v͕o!3*1;|#c ldPu9^`饭U; u|c&̝+4+r#Na <:"RfB' D;! ;,қ7 ?oۿ գ@ WPg%UI~$jh۪r̕K7^jx6òw0X (kX6@r`|캪2uE'?uݛ@_D3<̕NfqPڙ 9]}J1;*IQ|AαԲ z9uY^:+Z9x 3XiiegO=Ea=t]6[O#P8@YE|{LJq6[ީ*8߸ZUx| 3yǜQ%4ڕ ឃ*ǻFOyBPg}8DqbE,\!^xkڃCfP-Y?ˠqqX#D9*ȹVV,=FcDh:qnSJG1'q_]m|f2E +4Ƀ i e2q#*Y88ɏjRn˹ơ*#NUu[Yr~ En92!  w}3%d7"ٜKtٕڲXsګW!%2)nWTHv!4\a^Xd~yKڮdl@: 3dKEjC= =w7 5t~Y<  @ 3vN.+/jVSJU'z| ʢ^_\?+ g!:P,7]3 od#a)¸aAT!MM.N`+uLGfWjNh虴U gk׬ U3رY:cN:2xg9GP߻d"<܂#~\`&2"  ']-a['UIW%ՃZ86QLPq^z9uJMei9 k|=̵N#lKqpm8mUihllj_ڳWl/9p ^-BvQٍZǺ.7I#SgWrƞHCnWX1NO ✖P4XCڰs_J-{ƵX:@'嗩*$FH9=%*_Ɩ(z/Hg)|T%XesK oWFwH8'U[urH#>r9? 2(J8"X׬tur2|珦f,D&I?"_U&?A q5#NR62??x +LrĔk$ǢQĩAU"N8Ѷ?87(s2 OTXS>V5#1Z;HUb#\B'r Q~.9:+s;!B9ZRV9Ղ͎oVBOsK. #۞Ð#Cr ԣ aT;BKl@wYR̫jg-^yp-OKA@yĵjUI<%a 9XQqT YEĠ⩓Wє׶שg ?$ GV)Vru \O"5%:E;~kojۖeEtδ5\+8D󺃈RU:qLqxS[Ǽq87ɽ≺[W|t.)T< =w#|e>sFPY!wc;X2G*>F#Ub&>\'5ƕ\wG]osmt\e6DDDYo 3PKiRU"}e@@ b,#?7خWQQǐId972Qđ`I 92Cc V?E{OZg2@2獟C v\WvÏ A9ǖJqVU 0NRwwwo熲7r׿rE|IPr pWuxgOqN.*9N;;l" X}b|mI}Ga ձ-vzu l,kB)u&jy$OT B֘#x顛9!2,&E$_ȏ>cBh~9e"*#c9S5] qf9/jiq Uǥs*=otTRԲ*qnMjM]s_/rC685 qس7}xر/N}XsqyãPV0:bԉe 8}LwDDq,lsvPHsj;2%^̴+u.:gA\*=`vdjL DWJw{GV`X||+T9P`W=~AXR磼ryfN_x!^9$} ?0Jn–̪"U8JbRVS%#MV:ۺꃧ\ᷮ@Ƨon#xs18eJC0J=YKf W-<xYeMêҢgm$ZK^=Ҁ"ZT5?+eHjy\ ^w`،rdHdj.^e}5*Aa0*s LZpw.gCı".&"S9 pV'%Z̩kG&ƛv 8$0lߞ[~w;>|ȟ@PF`(juD}Bys_!ZENlDN늖;]b9LR:A29 IASMxtBeSthyl)Cr4QBB(z|"'glw1.,SOBarlnȼWfcru1:+ {Cddnf̒*骂@gUsԚ*&qP0P}ҘTHrIG; Ey?.o9pŲwk#en9b:G1Mm\ )hy?JJ'ڕ4r]JY"%NV8Sd88H%6)p~FAZXW4wO>Wpc$'abeJGx6g>x9b__6v;O ˷Fm6v;?wQnms+īE;赚RSAdծfHY.C+RT-Yٓc,?k [fΫ+G"xHh8ƒ9.߁ϣv'@L3E)/+:9 tx̙\PtUKƳ**rx́84VB\UjpKҘCF;6V-~)+›#ޤ9jR[W2@pb܉0%qv8"eg /(94#<9]RDO' CT9-[R Yv$E*fEXu 쉖1)[8`}t77LHh%JM7|eM"GcQ0I``A[]Z:X({/hH1kvơGG79 #)q8 h,PҘ7K$tC :ܿpo};+7GIW8sP9\Hs):m}#pȃd;;E4#w&VN+=.f6tyv;mQKH}V bh =hE6K6CS͖g׬)/VOuZ j]pV>yby74nB_ŝ#Êv)^ !c9Q7A18[J*ђAzؖbbMѢǶ'Vk_N\)L\5[nq#r$XkN0D3+G왃>{/)cb@Sqf`̱ rPH Jx'?)8z(‘)Ψ8pYٱ'F{v5+\'zJ㍯rco`(u <7"V$ǀ$@3!3[tsS" aaǼwY-j^Z8NYsd` rGx-}]>˺ g! ךtKŽg7 f=-r`s͝n4IBl#C2bH\*pvovx#5]>G޶jkO oU9nʛqud9>rǑ:9@:qFR]sg(+LȽWctk6Q{,/3 :-vw8n'N.^-% qʼnkQ;)-OS8]쟗-:yy'@zL Vʒs=j.r8u=,HyT:_Ѩ)S,BWթׅ;~-=&ñbes|*=x]KK'a{E1fP ]bǎ;zо553^xr_]wQC8j'vaFiCA-S=IIuU\ &X&Ua8>8hh؎?Xa 8g.w2t\anG3HP8٧xaȎ9.ؑ#7N#=ǎz2 !7glw_b#s|Y4eV@-ϬWm C+uْ2*ɞ~ԏU'cZx!$5$0'[Kjha_~88휐su[[7u7N{rIۿxC+/Ĝ*;:sҍJgqōt(GyHLIy}3D1Y7fNOXÍw:7GWBY@(KQivˑT9tb zW*H"UU+?[oƹ\d퓠APre+9cF_;*4?VDkiLvឰ^7cL͌g0:[9OR9 z',2 C,wL ǦRI1';ueЃ9JMNSouZ >` ~SzŬ7 [)rq@̨%Ig/[Ic5L_z&]J'@Wg X2?*^*ƕUላz t[7J (CwݦK SxcXps;':gGoGKOuԗz*?zW?!QC_, s4LUwW7#tvF2ѥV]]]mѕ%DP:QL[m:A.w r`mTnmGꍾnGE|5; o4/j1B( "bQ1QQʒĝ:u-dS!cs(#+]C9)=q n\A%w gsE ϵ {y)w6dO0kF#R:KKm6hwXcR3bY_!|Y $:2TWU2gV[M'9i=ple(t{ ry'*?&[@u&^9oqJS4f*4)2c&8Dﰎjcśh"&-g9u'WǏ>wx斤z3'o]7?~?%gpc&wuD0DX4Hr:Lt{R;ұC:˷%-6^7u 2=W~)]tF9FA]!Q^9 Z `,JB#=1xTo$؊5: Yk gl}wHreħ뎰Q͕X<E=!9zdc۝/=AGڻwdKGSc͙s`dЎֆ3?޷wnp҃7z}_ޢfuUCC]C3M~L {IGgϖC 0ܟfNd:xPޱu;+C2\@ !G?%)(PX([9ɛ;b e}AbTmFg_);aޤSjQ/]؈~jAF 1[u#pnͲAʢo=}?6mnO.Lȹ~ t1C<+r$R l 8sTS-+T!NYYy˦P\7Yh-SMao5y(E֝ #GFi m>ɼ㿚BnHM᎞9Vos,œ4i@%B9[zFdtȮtUP No%ĎY!kůӈ'͕جSmZDX:Ӆulykx<oĦRnUH~ȂV7pP+޸x;/?1*us_:գJ^04RI+8 *I#KJE S(2ck*Qo o9uIN'9 N|F=Y(G&,vɘăh"S29^t ,=]\y7ó<Ec=+ ˅=tNk[kifW~9J#gkd]Y7*ps-6L o-aF9tؑ'_3|{r~|ZҜQSUm7 ԍ7)>VjY_6޻L|,1 9Q8O)aQ9' #V*Szoo&~-pRAe7oN}s5Xh_W6 GqzZ sM 9h3ԍȭVWhux>KyvW=m{䴎UNѩ@b*qxsy.^ҸTISEM M==LENTyAy Fe(ƛQE9qqhctU0ry޾bNDKWgw^p0 NvN樏'rF_f!sd&ǍVOo N/uJwW=lNslrcÒV0ɣMq7&I+u%!!";65.y98 Óͅŗ¨J*XvŢ+h*m w{5YP\F@Y@B5nN n|"qd͘LXH#E!Nn']jD 0' 8+त$=nss&&v;n .,-Ku-[bgAu N`Pc촷$PtM初: us\ZF`>@3 @٨n/|ӧ>!ft]tn~u8v 22tN΢{G,iFsw@ܑy ְNJ8vs02ˋhS<1KR3S;"R`_/c^*|f:*vʖ'p}@zC/mO)su&b`73J$ڃN(_ޡkShɰbK &%UCdd|cwSpϘVXtO5惣#]D;PqAz1'G>o^r` Dǫc:4pطX+ȃ3;:R35,:_Iӓ`e,Cp")uB)x),(ªWZE keBŤ#&ȉIrZ=L(;7k?:(Z"#H=8|=-x_z 95Ώ {9KMTWYY)^8 [ \"w+onĀ:67\Wta%;s@Ls^Ҹo?Ǣ͑$1q5:^Gv!\^yjs`P@ yvٲ%`a\"TV \5䪉>Fnh`sh޷k6BMnrT760a#Ln*p!{֑;{Λ=m$-8| g줥'1s ƛ*6بUW,p`7N\l9s8V9'_WH'F?/wu(c'.&C)7@wsHڬ83 utrD_#J'Pda1 *tBDj{#'bc'4rٖ/|v@DƆ1<^7|%Q .2'LO R7H䍲7lj09t_уFW.xGq8dT8R_QQъ0ņhphfGF;ovzq n \psN\xWO:ssJQVh|tα*GWRGhzg"8gVյ+Hiwҧ#ut%ʝA)C(+}X07{ {y!& MwL=ʂBFK6Jo3SL7q6۹H+#>*W锞|5W.888~s4^^TTRRfT$Tq޴]o<}CayhӜJps k+JWƳ)_/dnj,sS7~-媗7ED)c5Xl4;S8I7P!RSϞ@MS7>G;'`8y>]JWA!c;`cY}aDx ){P̮DHQ)Iqʣ x6NLW:Xjm[1[ZCw'Lҭk[TюΠW7a.J?⍱!n2G׮lw1lt9yء?.25*JPQd&CJcN?-+@|SI46DxsS o 8>ǑiΡ&du 1Ay=Vە{ + vO$'J97 ȟx*)M5W*'~xei \IA-Aqc @Pc5/2ڔx7ps<95ܤHΞ9M#_ЎucjpP pL`|S01 x38#ɽ,S٭ g}9J4&ޜǽftxcdciSf9uZg_*< ʃc;wef:47x` ޿=tccr*ڜ!'@v<ôU-* -`bB^p_nsJeD7dȐ72|=4:ތ4:ܜ={=A987F[t4ϓbxss*.[UOuD9_wΌ2:/ޤ O8 r*~H B_7ǰ/Հ#X`brΉq[!+؆HiMs6YV9^ dPsdvE!ͱs5QQa֦U;b hSjRnl-|g,ty7/nI`N=5"Z0:|D3kps/o:y9/-8UخkrN`Lz0td^~^ÑB|ml{M[1bH=۹JZ'@Va#%p/weQǏ AK[91_XP ˱FSo?Fi8kWQ1ʛO7 6a(:KS)<ԅUƤ;{γSp3ⅴN]Y7N'F=~b yqKe#19;Dwמ+UrQs}3RG%Nog4;ڹ0!9s̧ě= wNmyȅUasy]z4Uiy]汓eSeiʳ vbmN^:-!NX-+i='^97 [3ϙfefiina*1WvR<܁p.99VysRe?RH5^oҨCHvE:'8u* mgb9}>zYD*u 0X^U d="+e{O g _M+sJXL,0+sӢSCo>Vt Vԭz)i6½_M1O={cqn>)Y|S^CwEW^1*O9Ή=6Dz92S0HաRDP7:8r7X Qp7.:;n9wI`.htqܹ;O;P⥥.[,YZo'/WYWYSэݛ6m?08g/cɓ?-h+:ɰjXN-0c.IܙLޗV3-Hʥ=d!'ϊݼ^^) η]9tN`st"+ӥ+ I1- K1$P-hB[ڡhZdسͩN}*ܧÕ_cp^_`jw!E9ȶki咍{n18kWrOٻCG<:qnӉ%ωl8Qمrg#N8t?'}~#~E^Dubo/R$gm.\SFCͩ`^8sեN(vWJPtr~Qqrcr7۷;MD{HRT;5J'N]h?g o.pΞwjpp SQx1Y]^)&:`%S*Dհ=碊eQn2~BρRvQd~~+;<Ừ s&MWob܉gx/SS=Fc/]_v3͐CFV^٘C {*aoC;n# 6pڋdo3}qӇF5Xٻgo:itfͅr7.ܳFl>IC /I)u?A%pR P(uEqCp gS))ՔV>M#v)ׯ𢺺چkFR %w۟ܽUrw㱅uVHP"0kɑu^ryEV5j 4tgdPOjsl"CC:|CzաKCk\m6jil }QTc=1f៤%SJ+zbK 3?Q01QҦ` 5'MA\TA=GUsZM Sʐ@RWsFp[1'޳=nkJ]踙mɝt'wʤ"Ŏ9z,,lN 7p:PT"Jޛ=YЁLgwک^ɣX569^ANwg"; {6Dckq #. Fn⹔[ =N _f-|L73$K~|:BKGV俴RʶO_gpΌ\yeW4g*I^TH# CAӂ5"֤͟ -4 x"J+߉ XG܂A0 0OiAX70@%Krcԙت7 ޤ#>))L"NϝсU͑u9 {W졓"NY!f-Ltm̀e=~Y*hn"ٍYP HF7[y[m[6uldžB'/݄_C7f泩h>[9{j{棯M8Y&A7 +Vx險ꤘ\ Njd,W^-ؘ[ ^-x/ܻpYG!xdiĺs3(%]7 16S6ϳ5*FP+~<9bp1|Fn[ @ 'XUWcs|PlHS>bm qܦ7mtKY<5S 7L~R;( l_ZzOf'R2Ek6V\rv.}w : -21A\IL.i* U4ОQ6697ihq-OR4[y7J\2jlnlVfIEv2I~Hzw?p;uQ|t Νk؍F2{?2y@:BSAvݔr_ _u.KW YF8q=5wz/ARwksaFmMkThŊiEqqq򲨰'Oqʕ+Wr[ݳZDy'q f fob\e_2-@sv<9y¸O2p5(m&JQaj̙m~39?s:c~_,[#AeB|! K™]/oe) f)}  A͊紒sxKKy"U765,ǨG&iڤGm)0u/mӨh>]s빴Hsβ/pə5L 5 3h0fȩFj䁍^(,pe"5L@"gA!3DSpEݣJQj`'%եQ)@ujkjRiRVa(M @r=WYY/ pXΧP oA)xX ] ϧs $817A9 !!I3>!x3Q$HO.0,`wѯW>LqF`XCJhr 2a QdqN )F.}H‚PȽ{>avZ戠6ɠg:ʚKN >ćC'|S)y=*WBY65<%Q&456D!B555X 0uN&Gԇ;ϖwv_)F Sܒ lM<$~u j\U~,pYZ~Kϋ7TpOQX↋BzCo#dHyg7 :Tp"gLYzb$XE?)c#R,WK!7PP.fb BFcL6Iq /S7Ob`3{ sRچ'R2Fi3&|DMRcݯOT/ #hֱ{U:}k/SxyݪUHJlm>J/vӾ߾ ;泑|څO8SHÄsI"Kʛ*p3pɣGmAt`,mm)m@ эM(DDI|#68vpe-AaCO0]HhXWJ)u*axqFl V \-Js'ǢJ+zgT2)ϛfHƵ,DpdAOX_rܤ-_!g L)l%?:(ߙ XCIIH]Gf fQe[v&lHwQ繼/?Мu͙k8"l>lWz'*4i6g\>M;OLD dyp cc6&MRkJ*X[Q.c*J1ZɃb)rJ× [ YU7)Ki4Y]G:F&LujHc 7l੕HV@D F%"?R$τƘB -b6*IӊEi8$fWƞM6fyQd mhcVI5襇{gv]<"f @Z?8(=A.,zui)L[ZhrmWݪcgn kOITvi-?du>:EojF]qZ8J^+3q\HPantȣ#4@%؜`q,Z 'Lx0PBIDP :ᯇ7.V)/XZ-!KpfI2KуAFkM.6$s Aٻl.5Ҍ;|yVKqjA#ŌMY&XTY%hp*LK r)o:(١YYno!Rm;;>a'>4 lEpA c!ef6[m(:__#S,ijEη^y*UP_E$d:WJ/):Ht|/Z,,[jx<4SZ$ia0f %3Ȭ bS wdeV+(L@ q1jgPiylDkk!Q}ꆪGߢ6 {t-dZiW6J(1t5atEOMTGg!YxҶ] XhT imSr6gLst`N 6*5]TJ3ck,0MgXRȘqߍ,7ZGkʩFהcmm _m=HSfsr.Y7Vu.RP,@cpb$-viTJ*] bܭ(S%ݔ VJQGPLj6ZlYNl`鈹!>_=qș1.;W>„K{01Sr ɬIxhWI֫h٥J|lTÏ28ɕ eGpAP^<-e; Ҍ!>m1Hpː=Df(.l[G<:2N; Zњ#ky͆jVuLA eW(g< z@0i4Pa1%oKnYrؤ 2+ncU;fm)A.JYV$VFA{wr.l4.*]L6/m>w,aF5/ye8 :e 4z{Fa"݌M&l;557D2Iwm);:]ёdv+ɝqCm޸@r+.1L΄TW_~-=wJ^::xy|PʼzնGª\;SܶVU>R%ͪCPQÅKe_>IUsd롙#wOLG/0쭷KHe,l 75]3ޥJ]^1OJi;:\; 9%.[c&c M Y$@{i/+dmczCd)FҪA8MhV&GV>I|5=FOk o֔ÏN02Zhy,PK1R9:Ѳ-TxEsLrLkG@<؄t:%<3]vJ mӫ(r` GhqJ3Z]5WOuFmDw+/<@-NYnBre܈]*\xn,K|JkuJuuMPlWﵠJ=|u!mT fxr{2kA!"4 YR-MFls~|kglqU59sh_W&Nln 1vҸE?vn9JI ׈nwW&G=,x3R:cbUDaV*Կ 0N5<67I#z<\uO\ L,ps_YNu36m鵍խCft谏Q :㦌n@Dpc#9y3XӋÖv;5YpOV 1_uZ[Vuܬ4 Uyb%UaLUQUIQ/UJ5FL@9exb,(9w|guį60¯^Ef5y(Z;Ln`jcy6ֻ)3h$I"Qpcskی?@ }Y\z9x{YQ!F endstream endobj 106 0 obj << /Type /XObject /Subtype /Image /Filter [/FlateDecode /DCTDecode] /Width 1136 /Height 561 /BitsPerComponent 8 /ColorSpace 16 0 R /SMask 105 0 R /Length 6467 /DecodeParms [null << /Quality 60 >>] >> stream xZiXS a "2wo4Ȑ"BA!1 u@Txxu"h@2*5- ZpBVADZy { z>|~y/ MP (F&-On;Rz1}ϥ-aY^ I q &+؄dllS;UHZfD!?ЋNBdY[KGG[fqHL3Xw:3I1 *w 9lR일!{r{F{gпaa;E,MXjuoٖy;v‹Ke+"DZ#?W'Oni~UWcϝ?<84'#Oli&?o E#"7̴u{eƮľlR-q>0ۄ6G%-/(8,Jf|z&q:[0cDϛh؛"tB+yJ#!<_.Z$:i e"[رrL6s;Q.IP0N3Gaaa6AJ)wmطcٽds#K 봾WZeMIemhg/bi$8&L3gQo`f.l G0Ȍ 2J>B{bZN͢.L>,J )Q73eFXړqYl |ʨ C,CpubL3,9(GBWm7"h,3ko;*_5K(fJV 4vKcxE N[iHU}dn:+&L"&S*l#*"Y_cߚyHsa~ZX#;S|#m|sϥ#fYPȢJ<;]/ <Rғל6<[]9Q *V- { ^t&+`xKlXŠisN_=Bˣ?8*|_oϮU{uo@O$-9[9U=~E֕ҡNA7f7iE l(6nsiUizeZ?l9ɖaX3t.mn5 U.`?$ڂ3.{+Ҋ͌`Պp4VWHô۫S[NŜ>ɘѣN?ֽYrDa'8^U$![yI``=92ʯ7ꝋ]u<2LN?Qџz}+.u0 3+ϲeO3{k/uvl,:KT} {y}c[ڞ+{}sB&]Oׁ1ʾֹ2ltaDF94}?9ι+M<2GFn)9 ?vcTzOi5d~z_! $>7e˶15'/$ҥa|շ=wtf{L~6/a҆xFԙQiǏeH?m*o76-;g[ 4 O?eDd.ݑ}̲B`ygy p+(F,G7G}ۥh@徸"g rz}N}El. 1C H_ "%QvՐ‘uKaHu/KQ$s(3tXU@c^^Y,vr)Nz21CЖdRڶf"FM6iͮD.]-Pu'쥶IηI8vɐd7es v(pV hV|$^ңhxXB2%z(SE xAS_ y l7g00)_BP=}0[2%6cmX,sCXʰЪ vTԂO 1|VU TY)X@f3C1T5c[%5N=XΥ'ǖٵ .}ӝv2秩+X͝ǤZ꺕A=0d?8y>Z8|MI,Ku6_菞oߗmn.5uHggع.dN,Q]AӎW 3V>>CX|1|]V~۽m%=˥Kҭ$<MܣEpس NǏo3H^MSPb`zoC f5;6x,҃h2{Yj"񬛐?&YA0An{y,*I`XMy!LF:5٘C.}7J;NT"YOi*iF6Tx:/;H/ ;Ւ#~tZތPa$']z{EGq;. Ph)GA "P# S/e/mD]~ XjP3",|YjO̗U8L:0am] Ej(CUpң+ o &L~ƲN'`skFP=X0kiyGF~&aLld҃gaTY9j7?iGeY3?]fnqjC'G C3(m~&ZVnvJnnv:gW /q:5eV_ ڭ&4APgy2uiVl&a,cXG3m7 cڬAݽ-~wxKWSTyQwc炬-N|+|Όu=˾CG@vt# ex3cq/8#Y`5g*yK\TzWWfrcƓX0B׽QqfbcGc.PDԜ ];&juY2lt]_~u =1bZN wTiLGX>p7Ʊ A!*~sISQ(-&WE )Н/'"ά3'3xVG7ՊWZgH кgc Ѳ*>&x".nda$u0QI"#chi 0r`arB-S1f;#RTۡa6zI}ܹ 5(uYi݊zj.J] 8xjZ v:Y#6@gGh̨"}Dz|/[<iӨYB vx*c #Ūݘ YruՋ׼ЉK_Tkېs{ 2A2 lpM5]K }!fƲ)~U npt\xiZ)Ii0$g9'P';%0yJv64KBrz  lNAbb:`'P),HUq9K\SM߈͛Q~gpy 8;6B\-N͝}6'a&*P],B,z( diAlfE8FkKNW+-RXˮ\ǎ6w6_Ե.jyn[c=}*v܅} ECjkQzhoֿuSd$UӀ*&]\Jx R* *)E%4Ri |ګ(ۏw@41P-me;>r]%׫.&, $@@Q3TIs$@e"x w@},;;}U Tr hek&]i ju¸OJ.-uqʸqw|;#S7r}8pLj>zi4,2Knqy zKktjԶ@M )H"I`=oRyA0 w-F77b@Dr7!xy`-(HI4@ h AjQzglb<+vNvQŢ3}Č,\s~?-<*y iCR;dü 7_66Nh~A O«Ŋ2ܳ ˷쾇u.+8Yݐ&|p]p|h9q k5xc<@eB"3w"P0 @ZD+48%_us(,xDb&&^DM`ID(04A9LkU"iޭpģT`bR h)܍%%4PD) b %48J6Ǘ3"-rPGěsdyG ܷj\8.ؤceǿ?g56fng y~WE2{*ޚj__@ė@p E6\ l_F#syrr8# 1I=顥`1-NW\Ǐ}OKҍy=yEtk jFT'k@ЁF1BQpQ'tj4h-_ԳjN|Sp ZJ1[]\Z~:,uAdTMy PDAAՐz,%^&]/Q(ONA~Wnbn/Kˀt_V8^W*1D;9Gn 2 cp/L! endstream endobj 108 0 obj [/Indexed 16 0 R 217 <40F79640F797415CF7415DF7415EF7415FF74160F74161F74162F741F79641F7979640409640F79641409641F79741409741F7F05C40F05D40F05E40F05F40F06040F06140F15D40F15E40F15F40F16040F16041F16140F16141F16240F16241F16340F16341F16440F16441F16540F16541F16640F16641F16740F16741F16840F16841F16940F16941F16A40F16A41F1F796F1F797F26340F26440F26441F26540F26541F26640F26641F26740F26741F26840F26841F26940F26941F26A40F26A41F26B40F26B41F26C40F26C41F26D40F26D41F26D42F26E40F26E41F26E42F26F40F26F41F26F42F27040F27041F27042F27140F27141F27142F27241F27242F27342F27442F36E41F36E42F36F41F36F42F37040F37041F37042F37140F37141F37142F37240F37241F37242F37340F37341F37342F37440F37441F37442F37540F37541F37542F37640F37641F37642F37741F37742F37840F37841F37842F37940F37941F37942F37A41F37A42F37B41F37B42F37C41F47741F47742F47840F47841F47842F47941F47942F47A41F47A42F47B40F47B41F47B42F47C40F47C41F47C42F47D40F47D41F47E40F47E41F47E42F47F3FF47F40F47F41F47F42F4803FF48040F48041F48042F4813FF48140F48141F48240F48241F48340F48341F4843FF4F796F58041F58140F58141F5823FF58241F58242F58340F58341F58440F58441F58540F58541F58640F58641F58740F58741F58840F58841F58940F58941F58A41F58B40F58B41F68841F68941F68A40F68A41F68B40F68B41F68C40F68C41F68D40F68D41F68E41F68F40F68F41F69040F69041F69140F69141F69241F69341F79041F79141F79241F79340F79341F79440F79441F79540F79541F79640F79641F79741F7F796>] endobj 109 0 obj << /Type /XObject /Subtype /Image /Name /Im41 /Width 938 /Height 326 /BitsPerComponent 8 /ColorSpace /DeviceGray /Decode [0 1] /Length 305788 >> stream    !!!"#$$$%&&&''(()))*+,--.//0112233443667789:;<<==>?>?@@BBCDDEFGGHHHJKKKLMNOOPPN0    !"""#$$%%&&&&''()))*+,---/00112233444566789:;;<=>>>?@@AABDDDFFGGHGIJJLLLNNOPPRRF       !!!"""#$%%%&'''(()***+,--../0222222455566789::<<=>>??@@AABCDEEFFGGHHIJKLMNNPPPQRQ4      ! !!"##$$$$%%&&((()))*+,,--../0122223445667789:;<<<=>>@AAABCCDDEEFGHHHIIKLMNOPPRRSSJ       !!!"##$%%%%%&''(())))+,---.///02222334556678::;<===>??AAABBCCDEFFGGHIIJKLMNOPQQRSTS8      ! !!"!"$$$$%%&&&&'(()***+,--.////022234445678799;<<==>>?@AABCDDDEFFGHHIJJKKMNOPQRRSTUK"     !!"""##$$%%&&&''((()*+++,--/00012223344567789::;<==>>?@ABBBEEEFGGHHGHJKKKLMNOPQRSSTS:         !!!"###$$%%&'''('())**+,,,-//00112222346677899:<;<>>>?@@ABCCDEFGHIIIJIJKLLMNOPPRSSTUM$        !!!""""$$$%%&&''())))**+,,-.../0121223335677899::<<=>??@@ABCCCEFGIIIJJJKLLMNOPPQRSTTUU:        !!!!##$#$$$$&&'((()**+++,-.///00112223344567899:;;<=>>>?@ABBCDDDEGHIJKKKKLMNOOPPRSTTUVN$     !!!!!""""$$%%%%%&''((()*++,,-..//00112223455667789:;;<==>>@@AABCCDDEEFGIJKKKLMNOOPQQRSSTUU;        """"""###$$%&&&'((()**++,,,..///00122223455677889:;<<=>??@@@BBCDDEFFGHIJKKLMNNOPQQRSSTUVM%    !"#"###$$%%&&''((((*)*++,,-.////0112333345667899::;==>>???AABCDEEEGHHIIJKKLMNOOPRRSSTUVU;    !""#$$%$%&&&''(())))*++,,-.////0122233345557789::;<>>>??@@BBCCEFFGHHIJJKLLMMNOPPRSSUUWWL$   !!"##$%&&&&'''((()***+,,,--.//00012233334566779::;<==>???@@BCDEEGHIIJJJKLMMNNNOPQRTTUWWV:    !"!"#$$%&'&'('(())*+++,---..///00121234555677889:;<<=>>??@@ABCDFGGHIJKJKKLMMNNOPQRTTUVWXL#  ! !!""$%%%&''(())))++,,--.-.///001122234457778889:;<<=>>>?@@ABCDEFFIHJJJJKLLMMNOOQRSTUVVXV8   !!!!!##%&%&'()))**++,-/...///0001112234556788999::;<=>>???@AABCDFGGHIIJKKKMMMNOPQQSTTVVWXK"  !!!#"#$%%''(())**++,-..///0000111123334556789:;:;;<=>>???@AABCDEFGGIIJJKKLMNNNPQRRSTUVWXT6  !""##$%%&''))**+++,-././/0001212222344467788::<<<<==??@@@ABCBCEFGHIIJJKLLMMOPPQRTTTUWWXYI!   !!""#$#%%&'(()++,---..0//0001223332344556678::;<<==>??@ABBBCDDDEFHIIJJJKLMNOOQRRSTUVWWXXT3  !"""##$$%&&'(()*,--./..///0112223444444566778:;;===>>?@ABCCDEEFFFGHIJJJKLLNOPPQSTTUVWXXYYF    !""###$%%%&'(()*++--.////00012234345555667788::;<<=>?@@BBCDEEEFGGHHIJJJKLMNNPPQRSTUVWXY[[T/  !!!"###$%%%%'(((*+++-..//0010113334556656678889:;<<=>??AABCCDEEFFGHIIIJKLLNOOPPQRSTTVWYYY[[C  !"##$$$%%%&'())*+,--////0121223455555677789999:<<==>?@ABCCDEFFFGGGIJKKKLMNOPPQRSSUUVXXYZ[R,   !"""#$%%%%&''(***+,-./00011123345555567779999:;;<<>=??ABCDDEEFGGGHHIJKKLLNOOPRQRSTUVWXYZ[ZA  ! !"###%%%%%&&(()**+,,./00112323444556677899:::;;<==??@@ABDDEFFGGHHHIJJLLMNNOQQRSTSTVWXXY[[R)  !!"###$%&&&'&())**+--./012223344555689999::;<<<=<>?@@AABCDEFFFGGHHIJJKLMNOOPQRSSSUUWWXYZ[Z<  !!"##$$$%%&''')))**+,.//01122344555578::::<<<<==??@AABCCDEEFFGGGIHIJKLLMNOPPPRRSTUUVVXYZ[\O$  !!"#$$%%%&'''()***+,-/011122345666779:;;<===>>?@@ABBDCDDDFGGGHHIJJKLLMNOPQQRRSTUVVWWXYZ\Y7  !!!#$$%%&&'''(*++++,../1122334666889:;;<=>>??@@AAABBDEEEFGGHHHIJJKKLMOPQQRRSTUVVWXWYYZ[\J    !""$$$%&''')()*,+,,./0122234467788:;<<=>??@?@AABBCCDEFFGGGHHIJKJKLMNOPQRSSUUVWWXYYZZ\\X1   !""#$$$%&''()***+,--./111233456889::;<=>??@A@AACCCCCEFFGGHIIJKKKLLMNPPPRSTUUUWWYYZZ[\\]E    !!##$$%&&'(()*++,,../0112233456789:;<<=>?@@@AABCCDEEEEGGHIJKKKLLMNNOPPRRSTUVWWXYZ[[[\]U-    ""#%%%&''()*++,--//01122234567789;;<=>>?@@AABCDDEFFFGGHIJJKLLMMONPPPQRRTUVWWXYZ[\\]^]A    !"$$%&&''()*+,,-.//0112233356789:;<==???AABBCDDEEFGGHHIJKLMLNNOOPPQRRRTTUVXXYY[\\]^^R*   "#$&&&&'()+++,-./0012222335688:;;<==?@@AABCDDDEFGHHIIKLMMMMOOOPQQQSSSUUVWXXYZ\]^^^[;  !!!"#$%&&'((*+,,-.///112222346789:;<<=>??ABBCDEFEFGHIIJJKMMNONPPQQQSSTTUVWXXYZ[\\]^__L%   !"""#$%&''(*+,,-,-.//112233455689:;===>?@ABCCEFFGHHIJKLLMNOOPPQQSSTTUUVWWXYZ[\\]]^^`X4   !""#$%%%'((*+,-.--./0122334556689:<=>??@ABCDEEFGGHJJJLLMMNOPPQQRSTUUVVVWYY[[\]]]^_`_F    "#$$%&&'(**+,,.////1122345556789:<<>?@@ABDEFGGGHHJKLLMMNNPQQRSTUVVWWWXXY[\]^^^_``aV-    !!"#$%&&''()*+,,./000122234566789::<=>?@AABDEFGGHIIJLMMMNOPQQRRSTVWWWYYYZ[[\]^^_`ac_?   !!""$$$&&&(()*+,,-/01222223456778:;<<=>?@ABCDFGGHIIJKLMNNOOPQRRSTUVWYYYZZ[\\]^^__`bcP'   !!""##$$%&&'()**++-..01222334556789:;<==>@@ABCDFGGHIJKLMMOOOPQRSSTUVWWYZ[[[\\^^^^_`ab]7     "###$$$%%&''()*++,-.//1222345677789:;<>>>@ABBDDFGHHIJLLMNNPQQQSTTUUVWXZ[\\\]]^^``a`abG      !#$$$%$%%%&'(()*+,-///01223455678889;<<=??@ABCDFFGHIJJLMMNPQQRTTUVVVXXZ[\\]^]^_``abbbV,     !#$%%%%%%%&'((**+,../1112355567789::<<>>>@ABBDEEGGHIJKKMNOPRSSTTUVWXXZZ[\]]^__`aabcd`>      !"$%%%%%%%%&'()*++,.//0222346667799:;<=>??@@BBDEEHHIJKLMNOPQSTTUUVVWXYZ[[]]^__a`accddO&     "#$%&&&&&&''()*++,./012233566788:;;;<=>??@BBDDFHHHIJKMMOPPRSSTUVXXYXZZ[\]^^_`aabcde\4    !"#$%&%&&&((()*+,--./012234566789;;;<=>??@ABCEFFHIJJKLMNPPPRTTUVWXYYYZ[\_^__`aabcdecE      !"#$%&&&'((())++,--.001234557789:;;==????AADEFGGIJJKKLNOOQRRTUVWWXYZZ[\]^_`babbcdefV*      !!"#$%&&&')))**+,--./011134577789;;==>>@AABCEFGHIIJKLLMMOOPSTTUVWWYYZZ[]^_`bbbdddef`;     !""#$%&'&()**++,--./011113566889:;<<=>?@ABCCEGHHIKKKMMNNOQQSTUVVWWXY[\\^_``bccdefffL"    !!"#$$%&&'')**+,,-///112223467899:;==???BBBDEEGHIJJLLMNNPPQRTTVWWXXZZ[\^^`abcddffggZ/     !!""$$%&''()**++-..0012223356789:;<=>?@AABDEFFGHIJKLLMONPQRTUVVWXY[[]^^__`bccdffghc?    !!"#$%%&&'')*++,-.//112233456789:<<>>??ABCDEFGGHIKLLLNNPPRSUVWWWXZ\]]___`abcdeggihQ%   !""$$%%&''')*+,,../001223456789::<=>??@@CCDEGHHIJKLMMNOQQRTVWWWXZ[\]]^``acceefghh]3    !"#$%%%''(()*+--.//012223468899:;==???@ABDEFGHIIJLMMNNPQRSTVWWWYZ\\]^__abcdefgghdC   ""$%%%&((()*,--/0001123456789::;=>??@@BCCEFHHJJLLMNOOPQRTVVWWXY[\]]^_`abddefhihS'   !##%%%&(())*,-./001123456679:;;<<=??@ABCDFGHHIKMNNOOPQRSSVWWXYZ[\]^__abcddefhi`6     !!"#$%%&'()*+,../011233467789:;<<<>>?@ABCDEGGIIKLNOOPQQRUVVWWXYZ\]^^``abdeefhhfG      !"""#$%%&'()*+,-.001123355789::<<==>?@@ACDFFGHIJKLNPOQQRTUVWWXYZZ]^_`abbddeefhiT*     !!!"#$$%%&&()*+,-./00223446789:;<<=>>>?@ACEFGGHIJLMNPPQSSTVWWWXY[\__`abbceeeggh^8    !""##%%%%&')*++-./01234456789:;;<=>>??@BCEFGGHIJLOOPPQRSUUWXYZZ[]_aaabcdeffgheG!     !!""#$$%%%&'(*++,./01124467789:;<<=>??@AACEFGHIJLNOPPPQRTTVWXY[[\^_aabbdeefghgT*      !!"#"#%%%%&')*++,-/0112356788::;<==>?@@ABCEFGHIKMNOPQQRSTUVXYZZ\]^_abbcdefghi_7       !"""##%%%%&'()++,./0112457789:;;<==>?@ABCDEGHHJLMNOPQRSTVWXYZZ[\^_`abcdeefhifF        !""###%%%&''))*+,-/002245778::;;<==>?@ABCEFGHIJMNOOPQQSUWWXYZ[]]^_`bbdeffghhU*      !!!"###$%&&'((***+,-/0012467899;;<=>>>??ABCEFHHJKLNOPPQRTVWXZY[]^___acdeefhij_7 !        !""##$$$%&'''))*++,-//01346789:;;=>>?@@@BCCEFGIIKLNOPQRSTVWXY[\]^``abcefggijfD !! !!  !!    !""###$$%&''())*+,-.//00346789;<=>?@@@ABCCDEGHIKKLMOPQSSTVVXYZ\]^_`bddefgijjR&  !!  !!!      !!"##$$$$%&'')))*+,-.//0125679:;<=>@AAACBCDDEGHJKLLMOPQSTUVWWY[\^^`acdffghjk_2  !!!         """###$$$%&'())*++,-..00135778:;<=>@ABBCDDEFGHIJKLMNOPRSTVVWXY[]^_aacefggijf?   !!!  !          !!"###$$%%&''())*+,--./01235679:;<=>@ABCDDDEGGHJJLMOOPQRSUVWWYYZ\^_aabefgijjM#     !  ! !         !""##$$$%%%''()*+,,-..0/0235679:;<=?@ACDDEEFFHIJKLLOPQRSTVWWXYZ[]^_abeefgij[.     !  ! ! !      !""##$$$$%%&''()*+,--./011235678:<<>>@BCDEFFGHHIJKLMOQQSTUVWYYZ[\^^_acdefijb;  !    !      "##$$$$$%&&'(()*++-.00112345679:;<=>@BCDDFFGHIJKLMNOPRRUUWYYYZ\]_`bbdefhifI!    ! ! ! !     !"###$$$%%&&''()*+-//01223455689:<=>?ACCDEFGGHIKLLMNOPRSUVXYYZ[\_`abcdegggT+      !  !      !""###$$%%%&''())+,-.002234566789;<>?@ADDDFGGHIIKLNMOPQRTVXXZ[[]]_abbddghh[4   !!  !!  !!      !"###$%%%&''((*++,-001223456778:;=>?@ADDEFGHIIKLMNOOPQSTVWYZ\\]^_acdefgib?    !!! !! !! !    !"##$%%%%&'(()*+,-./01234666789:;<>@ABDEFGGIJKKMNOOPQRSUVXYZ[]^_`acefhigJ# !!!      !  !!! !!! !    !"#$$%%%%&'(**,-,.//0132466788:;<=>@ACDDFFHHJKMNOPPQRSTVXXZ\\]__`acefhhU, !   !   !  !! !!!!!       !"#$$$%%&&&()*+,-..00123356778::<<>?ABDEEFFHJKLNNPPQRSTUVYZ[[^^_aabdfhi_7 ! !  !  !! !! !!       !"#$$$%%&&'')**,-.0011234567899;<=>?ACDDEGGHJKLNOPQRRSTVWXZ[]]__abcefgdC !!   !!! ! !  ! ! !! !!     !"#$$$%%&''()*+,./01222345789:;<>??ABDDEEFGHIKMNOOQQSUUVXYZ[\]_`abdeggN% ! !! !!!!!! !!! !!!!  ! !    !"##$$$%&&(()*+,,.00122344689::<=>@ABCEEFFFGHILMNOPPRSTWXYZ[\]^`aacefhY/ !!!! ! !!!!!! !!!!! !!! !! !!!!  !      !!"##$$%&&'((**+,-/0112344678::<=>@ABCDEEGGGHIKLNOPQQRSUWXZ[[\__`abdeg`9  !! !!!!! !!! !!! !! !! !! ! !!! !!!     !!!""#$$$%&''(()*+--.0122345679:;<=?@ABCEFGGHIIJLNOPQRRSTVXYZ[\^_``acdfdD   ! !!! !!! !!! !!"!!!!!! ! !!!!    !!"""##$%%'''()**,-.00112345689:;<=>@ACDEFGHJIJKMNOPQRSTUWYZ[\]_``abcfeN$    ! !!!!! !!!!!!!! !!!"!! !! !!!    !!""##$$%%&&'())*+,-./011235579::;<=?@ABEFGHIJKKMMOQQRSUTUXYZ[]^_`bbddeX. ! !!!!!!!!!!!!!!!"!!!! !!!!!!! !!!!!!    !!!!""##$%%&'''())*+,../0122456799;<<>??ABDFGHIKKLMNPQQRTTUVXYZ[]^_abcdf^9 ! ! !! !!!!!!!"!"!!""!""!!! !!!!!""!!!  !!    !""###%%%&&'''()**,,-./012345679::;<>?@ACDFGIJKLMNOPQQSUUUVXY[\^_``cdfcC! !!!! !!! !!! !!!!!!!!!!!!!!!"!!!!! !!!"!!"!!!!!      !"""##$%%&&''(()+++,-..0023456789:;<=??@BDEFHIJKMMOPQQRSUUVWXY[\^_`adedM$  !!!! !!"!!!!" ! "!!!!!!""""""""!!!!! !!!!!!!!! ! !      ! !"##$$%%&''(()*++,-..01123467788:;=>?@@BDEGHIJLLNOPQQRSUVWXXZ\]__aceeU-  !"""!"!""!"!"!!! !""""!!"""""!""""!!""!!!!!!!!"!!!!    !!!!"#$$%&%&(())*++-...001234567789;<=>?@ABCEGHIKKMNOPQRRTVWWXY\\^_`bce\5 !! !!!""""!""""""""""!""!#!!!""""!"""!!"!!!!!"!!"!!!"!"!!     !!!!""#$%%%&(()*+,,,-../002334677889;==??@ACDEGHIKLMNPPRRTUVWYY[\]^`bcd`@ ! !!""""""!"""#"###"!"""""!""#""#"#""""!!"""!!!!!!!!!!!!!    !!"""#$%%%&(()*+++,--..001234556789:;=>?@ABCDFGHIKLMNPQRSTUWXYZ[]^_bbcaH" ! !"""#"""""""#""""#"""#"##""""""""#""!""!""""!""""!!!!!       !!"#$$$%&&'())*++,--../012344567799;<=>?@ACDEFGHIKLMNPQRSUUWY[[\]_`abbN(  !!!"!"""####"#"""###$$##"###"""""#""##""""""!"!!!!!!! !    !!"#$%%&&''()*++,--../001244567889;;@AABCCEFGGIKLMNPQSTUVXY[\]^`abcY5  !!!!"""""""#########$$$$#$$#$$######"##$###""""""!!!!!!   !"#$$%&&'(()))*++,--//00134457899;<=>?@ABCCEFGGHJKMNOPQSUVWXZ\]^^`bc^> !!!!!!"""""#########"##%$$$$$$$%##$#####$$####"#"""""!!!    !"##$%%&&'()))*++,,-./00123346889:;==>?BBCDDEFGGIJLMOOPRSUVWXZ\]^`ab`F! !!! !!"#"#"####$$$$$####$$$$$$$%%$$$$$$$##$$#######""""!!!!   !""#$%%%''(((**+++,-..00122345789:;<<=?ABCCDFFFHHJLMNOPQRTUWXY[\^_`baM& !!!!!!"""######$$$$$$$#$$$$$$$$%$%%$%$$$#$$$$$$$#$###"""!!!!!  !!"##$%%%&'(()**++,,-.//0123344678:;<<=>?ACDEEGHHIJKLMOQQRSUWWXZ[]^_`aR- !!"!"!!""####$$$$$$$%$$#$$$%%$$$$$%%%%%$$%$$$$$$#$$###""""!!!!!   !!"##$%%%&&'()*++++,-.///0123345689;;<==>@ACEEGGHIJKLMOPQRSUUWXY\\]__aW3 ! !!!!!""""####$$$$%$%%$$$$$%%%%%%%%%%%%%$$$$$$$$$$$$####"!!!! !   !!!!""#$%%%&''()**+,,--.///01122346789:<==>?@BDEFGHIJKLMMPPRSTUVWYZ\]^^`Z: !!!!!!"!!"""##"$##$$$%%$$%%%%%%$%%&&%%%&&&%%$%%$%%$%%$$$$$$##"!!!!!!    !!!!!""$$$&&&''()*+,,,--.///00112245689:;<==>@@BDEFGHJKLMMNPRRSTVWXZ[]]^_\A  !!"!"""""#$#"##$#$%%%%%$%%%$%%%%%%&&&&&&&&%&%%%%%$%%%$$$%$###"!!! !  !!""""$$%%&'''())+,----///001112224689::<<==?@BCDEFHIJKMMMOPRRTUVXY[\]^_^G$ !!!!""""""""#$$$#$$$$%%%%&%%%%%%%%%%%&&''&&&&&&&%%%%%$$%%$$$$###"!!!!   !!!"""##$$%%&&''()++,--..///0011232455689:;<==>?ABDEFGHIJLMMNNQSTTVWXY[\^__M) !!!!!"#""""#$#$$$$$$%%&%%&&&&&%&&&%%%%&&&''&&&&&''&%&&%%%%$$$$$$###!!!!!  !"""###$$%%%&''()*,,--..///0012324456789::<<=>?@CCEEFGIIKLNMNPRTUVVWY[[]_`R/ !!! !"""""""##$$$$$%$%&&&'&&&&&&&&&&&%&&&''&&&''''&&&&&%%%%$###$###"!  ""!  !!"!""#$#$$%%%&&&'()**,--..//00012233556788:;;<>=>@BCCDEFHJKLMNNOPRUUVWXZ[]^`X5 !"!!!"##"""#$$$$$$$$%%%&&&&&'''''''''&&&&''(''''''''''&&%%%%$######" "#""!  !!!!!""$%%%%&&&&&())*+,-.///000112334568899;;<<=>?@CDEFGHIJMMNNNOQSUVWWY[\]_[= !"""""###"#$%%$%%$$%%&&&&&'&&&'''''''''&''''('''&'''''&&%%%%%$#######"""!  !!!!"!"""$$%&&&&''(())*+,,-.///0011233456789::<<<<>?@BCDEFHIJKLMNNOPRSUVWXZ[\^\C  !"""#####$##%%%%%&%%%&&'&'''&&'''''''('''''(('('''''(''&'&&%%%%$#$# ####""! !!!!"""""#$$%%&'(())))*+,,,,-./00113344456789:<<<=>?@ACCDFGHIJLMNNNPQSTUWWXZ\^]G# !!"######$$$$%&%%&&%&%'&''(''('(''''(((((((((((((((((((''&'&%%%$$$! "$##$""""!  !!!!"""""#$$%'''(()))*+++,,--.//0022333556678:;<==>?@ABDDDGGHKKLMNNPPRSUVWXY[\]K' "!!!"#######$$$$&&%&&&&'&'(('''''((((((((((((())))(((((((((''&%%&%$"%%%$##""!  !"!"!!!"###$$&'''()))*+,,,---...0113344456678:;;<=>?AABCDEFGHJKLMNOPPRSTUVXZ[\]O+!"""!"#$#$##$$$%&&&&&&&&''((((((((()((((()))())))())((((((((''''&%%# &&&%%$$""!!  !!"""#"""#$%%%&''()))*+,,,---../01223444556789:;<=??@AABDDFGHHKLMNOPQRSTUVVY[\]Q/ """"##$$$##$%%%&&&'''''()()))((()(()))()))*))))))))))(((((((''''&$  "''&%%%##""!!  !!!"######$$%&&&&'(()))+,,,-..../01134444456789::;==?@@BCDDDFHIJLMNNPQRSTUUWXZ\\U4 !"###"##$$$$$$%&&&&&'''((')(()))*))*)))))))*)))*****)*)))(((('(('$ &('''%%$$###""!   !!!"""###$$$%&&''('(()**+,,-.///0012344555677899:;<=>?@ABCDDEGIKKLMOOQRRSUUVXZ[\W9!"########$$$$%%%&&&'&'&((())()))))))***)******))*******))))(((((% '''''&%%$$##"#"!  !!!! !!!"""####$$$%&&&''((()**+,,,-../011234555667899;;;<=>??ABCDDFGHJKLMNOPQSSTUVXZ[\Y> !!""##$#$$$$%$$%'&'''''((()*))(**)*)**)******+**+***)*******)))(&  ")('&&&%%%$#$#""!!  !!!!!!"""""""###$$$$$%%&&'''(())*++,,-..//01234556678899;;<=>??@ABBCEEGIJKLLMNPRRTTUUVXZ\YC" !!"##$$$$$$%%%%%&''''('(()**)*))*****+**+**+***+***++*++++***))' &))('&&&%%$$$###""!  !!"!""""#####$$$$%%$%%&''''((()*+,,,--.//00234455787899;;<==??@ACCDEFGHJKKMMNOQRSTUUWXZ\ZF% !""##$%$$$$%&%%&&'''('(()**+*+*)******+++++++*+++++++,+++++***' **)(''&%%&%%$$###""  !!""""""#$#$$$%%%$%%%&&'''((())**+,,,-../0113345567789:;;<=>??AACDEEGGHIKLLMNPPQSSUUVXY[ZI( !!""##$$%$$$%%&%&'''('(()***++++**++++*+++++,++,,,,+,+,,+,++**( !,+)(((&&&%%%%$###""!  !""#""###$$%%&%&%&&&&''(((())**+++,--../00123446677889:;<==?@@ACCDFGHIIJKLMNOQQRTUVWWXZ[K* !!!!"#$$$%%$$%&&&&'''((())**++++++++++++++++,,++,,,--,,,,,,+++( ',++*)(('&%%&%%$###"!!  !""####$$%%&&&'''&&&&'(())))**++,,,-.//01123445678889::;<=>?@ABCDDFGIJKLLMMNOQRSTUWWYYZM- !!!!!"#$$$%%%%%%&&'''('()))**,+++,,,+,+,,+,,+,-,,-,,-----,-,,,(  +,,+**)((('&%%%$$#"""!!   !!""##$%%%&&'''''''('(())*++++,,--.-./011223455677889::;<==>@ABCDEFGHJKLMMNNOPQRTUVXYZ[O0 !""""#$$%%%&%%&&''(('(()))***++,+,,,,,,,,-,,,-----.--..---,--) !-,,+++))('''&&%%$$##""!!  !!#$$$$%%&&'''('(((())***+,,,,-./000022333456778889::;==>>?@BCCDEFGIJLLMNNOPQRTUVWXY[R3 !!!#####$$$%%&&&&''''''((())**+,,,,,,,-,,,,-,-------.../....--* ).-,++**)((''&&&&%%$$##"!!  !     !!!!!!!!"###$%&&&'((((()))**+++,,,---./01123435567788999:;<<=>>?@ACDDEFGHJKMMMNOOPQRTUVXXYS5 !""#$##%%$%%&&'&&''((()((***+,,,,,,,--,.,----......-..//....*,.-,++*))(((''&&&&%%$$#""!!      !!"""""!"""#$%%%'&(())))****++,,,,--.../011234566788899:9;;<=>??@ABCDEEGHJJKMMNOOPQRSUVWXZU9 !""###$$$%%%&&&'''''()((())+++,-,,,--,.--.---......./..////.+#...,+***)))(''''&&&%$$$#""#"!  !! !  !! ! !!""""#"#####$%%%&'(())))****++,--....//01122445678889::;;<===>>@ABCDEEGHJKKLMNOPPPRSTUWXYV< !"!""##$$%%%$$%&'''((''((()+++++,,,,---...../...../..///0////, )...-,+**)))(('&&&&&&%%$$##""!"! !"!!!! !!!! !  !!!!!!!!!!"!"""#"""$##$$$%%%%%%&''))*****+++,,--/.///0123334567888:9:;<<==>>??@ABCDEFGIJKMMNOPRQRSTUVWYW> !"!""##$$%%%%%%&'''((('(((())++++,,,,---.././//.///./0/000000,  ....--+**)))))('&&&&&&&%&$###"""!!  """""! ! !!!!!!! ! !!!!"""""""""#"####$$%$%%%&%%%&&'(())***++++---.///0001234455678999;;;<=>>>?@AABCDEFGHJKLMNOPQQRSUUVWXW@  """##$$$%&%%%%%&'''((((())**++,,+,----.-.//////0/////000000+ &//..--,+**)(((('&''&%&&&&%$$$$#""!! #####""!!!!!!!""""!!"!"!!""####"###$$%$$%%%%%%&'''&&&''(()****+,-,-...0/0111224566678899:;<<=>>???AABCDEFGHIJJLMNPQQRRUVVXYWA!  !""##$$%%%&%%%%&'''((()((()**+++,,-,-.-....////000000000010, -1//..--+**))))('''''&&&&&&%%$$$$""!! !#$$$$$#"""!""""""#"""#"$#""###$###$$%%%%%%%%&&&'''&'''())**++,,,-...0/0011134345677889::;<==>???@ABBDDEEGHHJKLMNOPQQSSUVXYXE#  ""##$$$%%%%%&&%&''''())))))+,+,,----....////00000000000111, 121//...-,*))))(''''&''&&&&&%%%$%$#"!! "##$$%%%%$###""""#######$$$$###$$%%$%%%&&&%%&&&'&''(''(()))+++,,-.//0011112345566677999:<<>>??@@@ABBDEFFGHIJJLLNOPPQQSTVWXXE%  !!"##"#%$%&%%%&&&&&'((()))))*+,,,,,---.../00//0000111110121+ )3210/...--,+*))))((''&&&''&&&%%%$$#"!!!!  $$$$$$%%%&%%%$$#$$$$##$$$$$$#$$$%%%&&%%%&&&&&&&''''((()))*+++,--./0112222223566777889:;;;==??@@AABCDEFGHHIJKKLNNPQQQSTUVXXG& !!####$%%&&&&%&&'&&'('))))***+,,,,--....///00//01101112121+032210/.----,++*))))'(''&&&&&&%%$$$$#"!!!!! "%%%$%%%&&&'&&&%%$%$%$$$$$%%%$%%&&&&&'&&'''''''''''(((()**+,,,,-..0011233343456778889:;;<=>??@BBABCCEFGHHIJKKLMNOQQQSTUVWXI( !!!""##$$$%&&'&&&&''''''(()))***,,-----....0/000100111121222* 432111/....-,,+++***(((''''&&&&%%$$$###"!!!!! $&%&&%&&&''''''&&&%%$$%%%&&&&&&&&&&&&''''''''(''('''(()**,,,,,--../012234344556678899:;<<>??@ABBCCDDEFHIIJJKLLMOPQRRRUUWXJ* !!!"###$%%%&&&&&&&'''('((()))++,,---..-../-/000001012223232)+6432110/.---,,+,,++**))((('&&&&%%$%$$$#"#"!!! ! "&&&&''&&''(((((''''&&&&&&'''&''('&'&('((('('(()()((())**++,,--...//11223344456778899:;<==>?@@BBBCDEEGGHIJKKKLMOQQRRSTUWWJ- !!"!!""##$$%%&&&&&''''((())(())**,,-,-....././/01101021132331(26543210/.----,,,+++***)()('&&&&&%%$$$$##!#""!! !%'''''''(((())))'(((('''&'''''(((()()(((()(((()**))****++++,----.//00122345555677899:<<=>??@@ABCCDDEEGHIJJKLLMNPQQRSTUVWK- !"!""##$$$%%%&&&''''''()))(()****,----../..//010111111122322& $565432100/.----,,,,,++)*))('''&&&&&%$$$###""""! !%((((('((((**))))))))))((((((()()())))))))))*********++++++,,,-./.0/0011334555668999:;<>??@@@ABCDDEEFGHIJJKKLMNOPQRSTUWVJ. !!!""##$$%%%%%%&&&''''((()))))))**+-----../////01111222222232$.6655432100/-----,,,,,++*))))((&&&&&&%$$$$$#"""!!!!!#())((())**)*****)))))))))(((())))(())))*))****+++++,,+,,,+,,,...//000002344556779:;<<<=>?@AABBCEEFFGGGIJKKLLMNPQQRRTUWVK- !!!!"#$$$%%%%&&&&&''''(()))***))**+,--..-..///000121222322330! 56665532100/.---,,-,,,,++**)()(('&&&&&%%$%$$##"""!!"%)**)*)*****)*****)*)*))))*))))*)*)))))*******++,,-----,----.--..//00111234466779::;<==>??@ABBCDEFGGGHIJJKLMMNPQRSSSUWWL. ! !!""#%%%&%&%&'''''''((())****)***+----....///00122211222330  *87665543210/...-.-,+,+,,,+**))(((('&&&&%$%$$$$###"!#(***+****+++**********)********************+++,,,,-----.....././///01223445567779;;<<=>>?@ABBBDEFGHHHHJKKLLMOPPRRRTUVWL/ ! !""#$%%&&%'''''''''())))********+,,--......//011122222334. 3876665542100/.-.---,,,,,,+**)()('('''&&&%%%%%$$####%***++++**++++++**+***********+++***+*******++,-------..//////00001112233556667789;<<=>???ABBBDEFGGHHHJJKLMMNOPQRSSTUWL/ ! !"#$%%%&&&'((((''((()))******+++,,,-....///0/01122222233.%8876655443210//--.---,,,+,++*)())(''''&&&&&%%&%%$$$$),,+*+,++*+++++++++*********+*+++++**++++,++,,-----.--..//000112233333444567777889;<=>>?@ABCDDEFFGGHHIJKLMNNOOPRSTUUVK/  !!!"#$%%%&&&''(((((((())*********++,--..../00/000222323332+2:9876554443200//...---,,,++*+*))))(''''''''&&&%%%%$',,,,,,,,,++++++++++,,,+++++*++++,,++++,,,,,------.....///101112344444555556787789:;=>?@@ABCDFFGGGHHHIJJLMNOPQQRSUUVVK/  !!!!"#$%%&&&'''(()(()))))*********++,-...///001000122222333)  :;:9876544432210////..--,,,++***))(((('''('''''&&%%&+.-,,---,,+++++,,,,,--,-,,,,,+++,,,,,-,,,----....././///0012223344555555666788899::;=?@@ACCDEEFGGHHIIKKLMNPPPQSTUVWWK0 !!!!"#$%&&&&&'''((((())))***********,--...../01111112234332(0<;::9875444321110./...---+,++++**(((('((''(('(''&&&(-..-,-,,-,,,,,,,--------.---,,,,,---..----..//////0000011233444445555656777899::;;;==?@AACDEEFFGHHJJJKLMNPQQRSTVWWWK. !!!!""""#$%&&&'&''()(((()))))*******++++,-....//01111112233342% !9=<::9886544321100///.//.,,++++++**(()('('((((((((''+./..-,--...---...-.../////..-,,----..//././00011111111223344455656666778788:;;;<<==??@@ABCDEFFGHHIKLKLMMOPQRTUUWXXJ- !!"""""##$%&&&&'''())))(())))*)*******+,,,../////0111222333331! ,>>=<;99876544321100//.....,,++++++*)(((('('((((('''+/0//..--../////////....000//..-----...///000000112233333445556667777878999::;<<==>>??@A@ABDDEFFGIJKKMMMNNOQSTTVVXWJ-  !!!!!""""####$%&&&&&''()())))()))))********+,,-.////0011111233334/ 9??><;::987654432100//0///..-,+++++**)()((('((((((').2100////////00///////..0000000//./...//00000111112344445556666776788899::;<<==>>??@@A@BBACCEEFHIJKLMMNOOPPQSTUVWWI, !!!!!""###$#$$%%&&'''(())))))())**+******+*++,-..//00012111223444- )@@?>=;::9876654432110/0//./..-,+++*+**)((((((((((((+13221111//0000000/00000//00100100/0//0000101222222444445666677777788889:;;==>>>??@A@ABABCCDEEFGIJKKMMNNOPQRSTUVWWH, ! !!!""""$###$$$%&&''''((()))))))***++++****++,---..////01212223454,8AA@>><<:9987644443210000//./..-,+++*+*)((()((((((()0443322230000000100000110/111011110100001221223332344445677877788888989:;<=>>>??@@AAABBBCDEEEFGHJKLMNNOPPQRSTVVWWG+ !!!!"""###$$$$$$$&'&'''(()))))******++,,++++++,,-.////0001212222343)  (@AA@??><;:98875544332110100//..--,++++*)*))()))(((),355443332211100111001111101122222122121122322333344444556778999999:::9:;<===>?@@AABAACCDEFFFGGHIKLLMNOPQQSSTUVXXF) !""!"""###$$$$$%%&&'''(()))******++*++,,,,,+++,--./0///011122233343&  9BBAA@?>=<::98775443322211100//..-,+++++*))))(())()*0545565433332221111111111221123233333323344444445444565677789999:9:;;<;;<<>>=?@@@ABBBBCCDEFGHHIJKKLLMNOPQSSTTVWVF) !!! !!""""###$$$%%%%%&'''''')()*)*****+,,,+,,-,,,,,,,.///000002122223342" (@CCAA@?>>=;:998865433222121110///.-++++++**))))))**.465556665444333331111112222333344444444444555545566677889999::;:;;;<===>=>>>?@@AAABCCEEEEEGHHJJKKLMMNNOQRSTTVWVD( !!! !!"""""###%$%%%%%&&('(('())******+++,,----------....0000102222223340  7CCBBA@??>=<;:998754433222221110//.-,+++++*+***)))*,256655566655543333322222224344455555555655665566766777889:;;;;<<<=<>>>>>????@?@ABBCDDEEEFGGHHJJKKLNOOOPPQSSTUVTA& !!!!!!"""#"""#$%%$%%%%&((())())**+*++++,,---.----....../000001122323433- $@CCBBAA??>>=;:99987744433232221100/.-++++*+++******/566666666655555444334433344555556565556676677767777889:::;<<<<<====>????@@@@@@ABBDDDEEFFGGGHJKKMNOOPPRQRRTTVVU?%  !!!""!""####"#$%%$$$%&&'(('(())*****+++-,-.-........////011011122333343*6CCCCBBA@??>>=;:988766554433321121000/-+++++*+++++*,3667666666665555554445544455655556666677777779888899:::;;<<<<<<<<==>>?@?@AAAAABBCDEEEFEFGHHIIKKLMMNPQRSSTTVVWR=# !!!"""########$$%%%%%$&'())()((*****+*+++,,-......./0//00111111222333443' "@DDDCBBA@??>==<::988876554333322111100..,+++++++++,16776777777666666665555555556667766776787888899::;:;:;;;<<<<<<<==>>>?@@@AAAAAABCDEEFFFGHHHHJIJLMMMMOQRSTUUVVWQ;! !!! !!""#######$$$%%%%%%%%&'(())))****++++++,+--......///0001112321233333441#4EECDDCCB@@?>==<;::988766565443222111100/.-,+,+,,,,.577677777777777677766666665667778887877999999:;;<<<;<<<<<<<=>>>>?@@@@@AABBBABBCDEEFFFFHHIJJKKLMMNOOPRSTTUVVWP7  !!!!""""##$$$#$$%%%%%%%%&&'))))****++++++,,,--......../0000123333333343344/  "@EEDDDCCBA@?>>==;:::9878775554333222111100..--,,,,-38887777878778888788767777766778888899999;;<;;;;<<<<=>>====>>?A@AAAABBBBBBCDCBCDEFFFFGGHJJKLLLMNOOPRRRSTUVVVN6 !"""""####$$$$$$$%%&&&%%&''()*))**++,,,,,,+,---..///./////00022344334444544, 3FFEEDDCCCBA?>?>==;::98887776655332221111100/.--,,,06888887889898889988898888888778889899::::;<===<<<====???>??>>@AABCCCCDDCDCDDEDEEEFGGHHIJKKMNNOPPQRRSSTTUVVVK2 !!"######$$$$$$%%%&%&&&&&&'())*)*)**+,,----,--.//./////000001212334444545543' "BGFEEDDDCCBBA??>>=;;::99887776554432221112110/..-./4999988999::::9999888998899:::9999999:;<<<<=>==>===>??@@@@@@@?@ABCDEEEFEEEEEFFGFFGGGHIIJKKMNOPPQRRSTUUUVVWVK0 !"""#$$$#$$$%%%&%&&&&&'''''()))**++++,,,-----../00/00/0001112223334435455552# 6GGGEEDDDCCBBA@?>>>=;::::9877766545532222222210//..39::9:989:::;;;:999:::::98:9:::;:9:::;;<==>>>=>>>>>>??@@AAAABCBBBCDEEFFFGGFFFGGHHGHHIIJKLLMMOPPQRRSTUUVVWWUH/ !"#$#%%%%$$$$%%%%&&&&&&&''((()***++,,,,-----...//////00012132234334445556551 %EIGGFDDDDDCBBA@???>=<;::;:888777654443322222220///18<;;<;;;:::;;;;;::9::;;:;:9:;;<<<;;;<<<===>>>>??>??@@@@ABCBCCCCDDDEFFGGGGGGHGHHHHIIJIKKKLMNOPQQRSSTTUVVWWUE, !#$$%%%%%%$%%%%%&&&'&&&''((()*)*++,,---.....//0000///011111234444454466665-  8IIHFFEDDDDCCBBA@?>>><;:::::887876555443333332110/06<==<===<=<;;<<<<<<;;;;<<<<;;;<====<====>>????????@@@ABCCCDDDDDDDEFEFGGHHHIIIJJIIIJJJKKLMMMNOPQRSSTTUVVWWTB) !##$$$%%%&%&%&'&''('''''())***+++,---....../001110000011222223445656666776) (EIIIHFEEDDDDCCBA@??>>><;;;::98778865554444333331104;>>>>>>?>>===<<<<==<<<<<==<=<===>===>???>?@A@@@@@@@ABBCCDDDEEEFEEFGFFGHHHIJJJJJJJJKKKKLMMNOOPQRSSTUVVWXXS?' !""##$$$%%&&&&&'((((((((()****++,,-..../..//011112101112222333455555766774' ;JJJIHGFEDDDDCBBBA?>>>===;;:::8888775555454444333129>???????@??>>=>=====>====>=====>=>>>?@@@@@@AAAAABBBCCDDDEEFEFFFGGGGGHHHHIIJJJJKKKKKLLMMNOOPQQQRSUUVVWXYS<% !!""#$%%&&''''(((((((())****+++,,--.....///011111221222233344456666667771 *HJJJJIHFEDDDDDCBBB@?>>>>=<;;;:988878766665444443336=????@@@@@@?>?>>>=>=>>???>>>>>>>>>???@@AAABABBCBCCDDDEFFEFFGGGGGGGHHHHIIIIJJJKLLLLLMMMNOPPQQRRRSTUVVWWYP9$  !!!!""#$%%&&''('((((())*))***++++,.--.////0001112111212322334566777676787- ?MKJJJIHGFEDDDDDCBAA@?>>?>=<<;::9888876666655444446<@@??@AAA@AAA@@???>>>??@@@@??>>>???AAA@AABABCCCDDDDEFFFGGGGGHHHIIIHHIIIIJJJJJKLLMNOOOPPOPQRRSSSSTTVWXXXN5" ! !!"#$$%%&&&''((('()))******++,,,-..///000111122222222223345557777787886) ,KMLKKJJIHGEDDDDDCBBA@??>??>=<;;::99888777766554445<@@@@AAAAAAABBAA@@?@@@AABAAAAA@?@@@AACBBBABCCCDDEEEFFGGGGHGHHIHIIIIJIJJJJJJJJJKLMNOPPPQQRRRSSSTTUVVWYYYK1" !!!!!!!"!""#$$%%%&&&&'((()))***+**++,,-,,..///001112222223324333345667777788983"BONMKKJJIHGFDDDDDCCBBA?????>=<<<;:99:89887777545448@BAAAAAABBBBBBBBBAAABBBBCCCBBABBAAABBCCCCCCCDEEEGGFFGGHHHHHHIIJJJJJJJJKJKKKKKLLMNNOPQRSTTSSTUUUUWWWY[ZJ0" !!!!!"""!""""#""#"##$$$%%%%%%''())******++++++,--.-..///0011122222223334445667777779989/ 0NNNNMJJIIHGFEEDDDDCCBA@?????=<<<;;::::898887776546=BCCBBBBBCBBBBBBBCCBBBBCCCDDCCCCCCCCCCCDDDCDDDEFFFGGGGHHIIJIIIIJJKJKKLLLLMMNMNNNOPOPQSTTUUUVVVWXXYZZ[XE-"!"#""######"###$$$$$$$%%%%%&&%&'()**)****+++,+,,,,--..//000112232223334445555667878899:9* HOONNMKKJJIHGEEDDCCDCCBA@@???>=<<<;:::::9998877655;BCCCCCCCCCCBBBBBCCDCCCDDDDDDDDDCDDDEEDDDEEEDEFFGGHHHHGHIJJJJJJJKLKMLMMMNNNNOOOOOPPQRSTTUVVXWXWXZZZ[\V@)""""#####$$$$$#$%$%$%%&%%%&&&&&&(())******++++,,,,.-.////01111222343343445566777878988::6&><<<<;;;:::::99989?DEEDFFDDDEEEDDCCCDDDEEEEEEEEEEEDEGGHHIHGGFFGGFGHIIIIIIJIJLMMNNMMMNOOPQPPQQRRSSSSSSSSTTUVWXYYZ[Z[[\\Q9&$$#$$%%&&%%%%&&&''''''''&'''('(()())****++,,,---.....//001111222223343445667778888899:;9- >QPOONONMLLLKJHFFFEDDDDCCCBA@@??>>=<<<;;;;;;;:::99>EEFFFFFFEEEEDEEEEEEEEEFEEEEFGFFFFGHIIIJIIIHGHGHIIIIJIJJJKLMNNOOOOOOOPPQRRRSTTTTUTTUUUUUVWWYZZ[[\\\[L3%%$$%%$$%&&'&&&'(((((((('(''(((()())))***,+,-..-....////0112123332233333467778899::99:::7%.NQPPONONMMMLLJIHGFEEDDDDCCCAA@@??>>==<;;<<<;;:;;:=EGGFFFGGFFFFFFFEEEFFFFFFFEEFFFGGHIIIJJIJJJJIIIJJJJJKKJKKLLMNOOOOOOPPPQQRRSSTTUUUVVVWVWWXXXXYZ\]^]^ZH/$$%&%%%%&&&''''(((())))(((((((())*)*)*)*+,,-./.....//000012222222233343446667789999::;;;3 &FQQPONOONNMMMLKJIHGFEEDDDDDCBAA@@?>>==<<;;<<;;;;;=DIIHGGGGGGFGGGGGGFFFFFGGGGGGGGGGIIJJJJJJKKJJJJJJJJKLLLMMMMNONOPPPPQPQRRSSUTTUUVVWWWXXXYYZZ[[\]]^__YC,$%%%&&&%&&''&''(()))))))))*))))*********+,,..././..00011111233322233344455677889999:;;;;- 8PRQONNNONNMMMMLKIHHGFEDDDDDDCBA@@@?>>=<<<<<<<;;;=BIJIHHGGGGGGGGHGGGGGGGGGGHIIHHHHHIIIJJJJKKKKKJKKKLKMMMMNNNNOOPQRRRRSSTTUUUVVVUUWXXXXXYZ\\[\\]]^^``W>)%%%&&''&&&&''&'((())()))*)*)**********+++,--./////0001122212223333334445556778889::;;;<8%%JRRQQONNNNMMMMMMLJHHHFEEDDDDDCCBA@@?>>===<<=<<<<<@HKJJJIHHHHGGHGHHHHHHHGGGGHIJIIIHIJJJJJKKKLLLLLLLLLNMMNNNNOPQRRRRSTTTTUVVWWWWWWXXXYYZZ[\\]]]]]^_`^R:(&&%&&&&''''&'''(()))))))******++*****+++,----..//0011022233333333333345456677999:9:;;;<2'@RQQQPONNNNMMMMMMLKJIHGGEDDDDDDCBB@@???>=======<=======>DKLLLLLJJIIIIIIIIJJJJJIIIJJJKKKLKJJJJJKLMMMNOOOPOOOOPPPOOPQRRSTUUUVUVVWWXXXXXXYZZ[\[\]]^____aaa`[G0'''(((((((())()))))*))**+++,,,-,,,,,-,,,,-,,,-.///012233233333333334455566879899:99;;;;4!&ITSSQPPOOONMMMMNMMMLKJIHGFFEDEEDDDBBA@????>>=>==>BILLMMMMLKJJIJJJJJJJJKKKJJJKKKKLLLKKJKKLMMNOOPPPPPPPPPQRQQRSSSTUVVVVWWWWXXXYYYY[\\]]]]^^^`aaabbbYA-''(()))))))))))*****+*+++,-,,-------....-----.../00012233333333333445556667899:::::;<=;/ >STTRQPPOOOONNMMNNNMLKJJIIGFFDDEEDDCBB@@??>>>>>=>AIMMMMNNNMLLKKKLLKKKKKKKKKKJKKLLLMLLLLKMMMNNOPPQQRRRRQRRSSSSTUVUUWWXWWWXXXYYZ[[[[]]^^^__```accdcU=,)))())**,**+***++,,,+,,,,,-----.-.........-.....//0111222233333444445566778899:::::<<=7' 6PUTSSRQPPOONNNNMNMMLMLKJIHHFFEEEEDDDCCA@@??>>>>=@GLMMNNNOOOOMLLKLLMLLLLLLLLLLLKMMMNOMMMNNNOOPPQQQRSSSTSSTUUVUUVWWWWYYYYYYYZZ[[\\\]]]^__```aaccebQ9,*****+++,,,,+++++,-----,----......0//00///.//////00111222333333334445667888999;;;;;=<<2"'KVUUSRQQPPPOONMMMNMLLLLKJIHGGGFFEEEEDCCCA@@@???>?FLNNNNOOOOPONMLLLMMMMMMMMMMMMMMMNNNOOOOOPPPPPQQRRTSTTTUTUVWXWWWXXXYZ[Z[[[\[\\]\]^^^_``aaaabcdd_K6,++++++++,,,-,,,,,,,--..--..-././//000000000101000011222233333333334566777999:;;<;<<==9* >UVVUTSRQPPOONNMNMMMMLLKKJJHGGGFFFEEEEDDCBA@@@@??DLOOOOOOPPPPPNNMMMMMMMMMMMNMMNNNNNMOOOOPPQPPQQRRSSTTTUVWVWXXYYXXYYZZ[\\\\]]\]]^^___``aaabbbcde[D1,,,,,,,,,,-------..../././..///./0000110011111222222222233343333344456678899::;;<<==>=45PVVVUTSRRQPOOONNMMMMMLLLKKKIHGGGFGFEEEDDCBBA@@@@BJNOOPPPPPPQQPPOONNMNNMNNNNOOONOOOONNPOPQQQRQRRRRSUUTUVWXXXXYYYZYYZ[\\]^^^^^^^___``aaabbccddfdW?.,,+,,,,,,,,-......//0/////000/00/0011122222333332332233333333334444556778899::;;;;==>;, !IVVVVUUSSSQPPONONMMMMMMLLKKJIIHHGFGGFEEEECCBBBA@BIOOOPPPOPPPQQQQPPONONNNNOOOOPPPPPPPPPPPQQRRSSSTSTTUVVVVWXXXYYYYZZ[[\\^^____^^__```abcccddeefcP8-,,,,,-,,------..//00000111111111111122223344343443333333333333344455667899:9::;<<<<==6#;UWVVVUUTTSRQPONNNNMMMLLLLLJJJIIHGFGGGFEEEEDDBBBBHNPPPPPPPPPQQRQQQQPPPPOOOOPPPPPQQQQQQQPQQRSSSSTTTTUVWXXWXYYYYZZ[[\\\\]___`_`````abccddeeeefg`I3,,,---...--....///0000112111222221222233444444455554444434433434445567777999::;:;<=>=<. 1PWWVVVVUTTSSRPONNNNNMMMLLLKKJIIIHHHGGGGFEEEDDDCBHOQPPPPPPPPPQRRRRRRQQQQQPPPPPQPPQRRRRRQQRSTTTTUTTUUUWYZYYYYZZ[[\\]]]]^^___`aa`aabbccdeffffhgZB0-----.....///.///00012212223222212323333444444445555445555555545545677788989::<<===>>7% #GWWWWVVVUTSRRRPONNNNOMMMMMLLKJJIIIHHGGGGGGFEDDDDGORQPPQQQQPPQQRRRRRRRRRQQQPQQQQQRRSRSSSSSRSUTUUUUUUUWXXZZZ[ZZ[\]]]]]]^^_```aaaabccdddeffhhieR:.--....////000111000112232323232233333443343444545565566666665566667778889999::;<==>>=/ >8%.SXWWWWWWVUUUSRRQPONNNNMMLLMMMLJJJJJIHGGGGGGGFFFFMTUTSRRRRRQRRRSSSSSSSSSSSSSRRRRRRSTTTTTUUTUTVWVUUVVWXXYZZ[[\\\]]^^^___`aaabcccddeffghghijj]D1.../////001012223233223334344433334444455556567777877777777778777777888999::;;;<==>>=0 !LXXWWWWWWVUUUSSQQPPONNNMMMLMLLKJJJJJJHGGGGHGGFFGMSUUUTSRRRSSSSSSTTTTTTTTSTTTSSSSRSTUUUTUUUUVVWWWWVWWYYZZZZ[\\]]]^__``_`aaabcddeefgghihijkiV=/.////0/011112222344434544556555445554455566567777888888888888888888889989::;;;<<=>>?:&BXYXXWWWVVUUUUTSQQPPPNNNNNMMMLLKKKJJJJIHHGGGGHGFJTWWWVUSTSSSSRTSTSTSTTTTTTUTUUUSTTTTTUUTUUUVVWWXXXWXYYZZZZ[\]]]]__```aaabccddeffghihijkkleO6..///0001111211223445544444556666656654666667788988988889989999989999:::::;;<<<===>?=2 6WYYXXWWVVVUUTTTSRPPPPONNNNNMMMLKKKJKKJIHHHGGGGHKSWWWXWUUUTTTSSSTSSTSTTTTUUUUVVUUVUUUUUUUUVVWWWXYXXXYZZZ[[Z\]]]^_```aabbbceefeefhhiijklll_F2//000001222212133445555554445666667777665677778899999999:::::99:9:999:::;;;<==>>>>??:&3QYYYXXWWVVVUTSSTSRQQPPOOONNNNMMLKKKKKKJJIGHHHGHKRXXXXWXWVUUUUUTTUUTTTTTTUUUUVVVVVVVVVWVWVVVWWXXYZYYZZZ[[\\\]^^^_`aaaabcddeeeffghhjjjjkmhU=0000012122333333444555666665566777777888877878889998999::;:::;:::;:;;;;;;;<<<==>>???=?>????8% )>XYYYXXXXWVUTTTTSTSSRQQPPPONOONMMMKKKJJKJJIIIHIIQWXXXYYYYYXWWVUUUVVVVVVUUVVVVVWWWVWWWXYXXYXXXYYZZ[[[[[[\]]^^^__``abcddcdeghhhhiijkkllmjZA0/00012334443344556666777788888889887999:9:9:::9:;:;;:;;;;;<<;<<<<=<=<=====>==>??@@@=. &3UYYYYXXXWWUUTTTTSSSRRPPPPPPOONONNLLLKKKJJJIJIIJOWYYYYZYYZYXWXWVVVVWVVVVVWWXWWWWWWWWWXYYZZZXYYYZ[[[\]\\^^^_^_`_`aabcdeefeghhijijkkllnmgP9///00133345554545667676667999999999:::::;;;;;;;;;;;;;;;;;<;<<<=<>>>>>>=>>??>?>??@@@?7& 8QZYYYYXXXWWUUTTTTSSRQQPPPPPPPOONNNMMLKKKJJJIJJJOVYYZZZZZZZYYYXXXWVWWXXXXXXYXWXXXXXXXXYYY[Z[ZYYZZ[\\]^^]___```aabbbcdefgghhijjklllmmonaH3000112334545556577777767889999:::::;:;;<<=<<=<=<==<<<<====<=>=>=>>>????>??@?@?@A@A@=,,NZZYYXXXWWWWVUTUTTSRQQQQPPPPPPONNNMMLLLLKJJJIIKOWZYZZ[[[ZZZZZZZYYXWWWWXXXXYYYYXXYZYYYYZZZZ[[[[Z[[\]]^___``a``abbcccdefghhiijklllmmnolX?11112234445555566777788888899:;;:;:;;;;;<=====>=>>>>?>>>???>???>???@@@@A@@@@AAAABAA@6$6BY[ZZYYXXWWVVUUTTTTSRQQQQQPPPPPPOOOONMLLLKKKJJJNW[[ZZZZ[[ZZ[[[[ZZYYXXXXXXYYYYYYZYZZZZZZ[[[[[[[[[\\]^]^__``abaaabccceefghiijkkllmmnonfN921122233454565667778888999999::<<;;;<=<<==>>???>>????@@@@@@@@@@@A@@@A@BBABBBAABBBCB<*!:W[ZZZYZXXXWVUUUTTTSSRQQQQPPPPPPPOOONNMLLKKKKKJMV[[[ZZZZZ[[[\[[[[[[ZYXYYYYYYZYYYZ[ZZ[ZZZ[[\[\\\[[]^^____`aabbbcbcddeegghiijklmlmmnom]D4122233445455566788788899::9:;;<<<===<===?>>>??@@?@A@@AAAAAAAABABABAAABABBBCCDCCBCC@2"=SZZZYZYYYYXVUUUUTSSSRRRRQQQPPPPPPOOOOOMLLKKKKKNU[\\\[[[[[[[[[\[[[[[[ZYYYZZZZZZZZ[\\\\[[[[[\\\\\\\]^____``abbccccdeeffgiijjkklmnnnngT<322233444555667788889998::::;;;<<======>>?>>>??@A@AABBABBAABBBCBCCCBCCBCCDCCDCCCCCC9% ,NZZYZYZYYYYWVUUTTSSSSRRRRQQQPPPPPPOOOPOMLKKKKKNU[]\]]\\\\\[[[[[\[[[[[[ZZ[[[[Z[Z[\\\\\\\\\\\]]]^^^^^__``aaaabbccdfeffggijkllllnnopm^G62233334455666678999::9:::;<;<<;<=>=>>>?>?>????@@AAAABCCCCCCCCDCDDDDDDDDDDDDEEDDEDC>. 'FZ[ZZZZYYYXXWVUUTTTSSRRRRRRRQQPPPOPOOONONMLLLLNUZ\]]]]\\\\\\\\\\\\\\\[[[[\\[\[[[\\\\\]]\]\]]]]^^___```aaabbbbbccdegghhiiklmmnnoopiT=211233344566677789::::::;;<<=====>>>?>?@@?@?@@?A@AABBBCCCDCCCDDDEEEEEEEEEEEEEEEEEEB5 ?X[[ZZYYYXWWXVVVUTTTSSRRRRQRRRQPPPOPPOOONNNMMLMT[]]]]]]]]\]\\\\\\\\]]]\[[\\\\\\[\\\\\]]]\]]]^_____``aaabbbcccbcbdefghhijklmnoooon`H6011123344555677889::;;;:;<=>>=>???>?@>@AAA@AAAAAABBBBCDCDCDDEEEEFEFGGGGGFFFFFFFFFF<)7UZZZZYYYXXXVWWVUVTTTTRRRRRRRRRRQPPPPOONNNNNNMNT[\\]]]]^^]\\\\\\]]]]]^]]]\\\\\]\\\\\\]]\]]]]___`````abbbccccdcccddfghiiijkmnnpqpiT>1101212344456677889::;<;;<<=>>>??@?@@@@@ABBABABBBABCCCCDDDEFEFFFFFEGGGGGGHGGGGFGGGB1 2SZZZZZZZXXXVVWVVVUUTTSRRRRRRQQRRQQPPPOOMMNNNNNT[^]\\]]]^^^]\\\\\\^_^^^^^^_^]]\]\]\\]]]]]]^^^_````aaabbcdddedcedddefgijkkklmnppobI500011112234556778999:;<<<<==>>???@@AAAAABBBBCCCBCCCDDEDEEFFFGGGGGGFFGHGGGGGHGGGGGF:#)P[[ZYZZZZYYXWWVWVVUUTTSSRRRRRRRRRRQQPPOONNNNNOU\_]]\]\]]^^^^]]\\]^^__^^^____^^]]]]]]]^_^]^^__``aaaabbbcddeeefefeeffgijkklmmnnpjV>10011121234355667899:::;<<===>>???@@@@@AABBCBCCCCCCDDDEEEFFGGGHHHIHHHGHHHHHHHHHHIH@+  %L[[ZZZZYZYYYWWWVVVVUTTTSSSRRRRRRRRQQPPOPONMNNOU]_^^]]]]]]]^^^^]]]^]^________`_^^^^^^^^__`_^^_``aabbbcccdeeffgggggfghhjkllmmnoobI4///0112224445566789:99:;<<<<=>>>>??@@AAABBBCCDDCDCCDEDDEFFFGGIIIIIHHHIIIIIIHHHHHID2 GZ\ZZZZYYYXXXXVVVVVUTTUTTSSSRRRRRRRQQPPOPONNMNU\`_^]]]]^^^^^^^^^^^^^^_______````_^^^_`````____`abbbccccdeffgghhihghhiiklnnnoojU=0/0111122334556768889:99:;<<=<>>>??@@AABBBBBCCEEEEEEEEFFFFFGGHHHIHIIIIIIIJJIIJJJIG8 "BY[[ZZZYXXYXXXXWVVVUUUUUUTTSSSSRRQQPQQPPPOOONNT]_`_^^_^]^^^^^____^^_____`__````a``_^_``aaaba`_a`aacccdddddfgghhiiiiiijklmnoonaH4.//0111123455566778889::;;<<===>???@@ABBCCCBCDEFFFFFFFFGHGGHHHHHIIIIJIIJJJJKJJKJJ@(;Y[[ZZZYYXXXXXXXWWVUUUUTTUTTSSRRRQQQQQQPPPOOOPU]`_``_^^_________``__``___``_``aaaaa__`aababbbaa`abbcdeddeeffghhhijjkjjjlmnoojT;/../01111334456666789899:;<<====>?@@@AABBCCCCCDEFFFFFFGGGGHHHIIHIIIIJJJKKJKKKKJKJD07X\[[ZYYYYYXXXXXXWVVUUUTUTTTTSQQQQQQQQPQQPOOOPU]``a``____```_``````````````a```aabba`aaaaabbcdbaabccdeefffffghhhiiijkkkllmnm`F2../001122333456677778999:;<<==>>>?@@@ABBBBCCCCDDFEFFGGHHHGHHHHIIJJJJJKLLKLKKKKKJH7  1V[[[[ZZYYZYYXXXWWVVVVUTTTTTSSSQQQQQQQQQQQPOOOV^aaaa````_`````_````aa`aaa`aaaaaaabbbaaaaabbbbcdcdbbcdeffgfgfghhhhiijkllmmmmgQ9-.-./0011223445567778889:::;;<=>>>?@@@ABBBBBBBDDDEEFFGGGHHHHIIIIIJKJKKKLLMLLLLLLJ>& *R[[ZZZZZZYYYYXWWWWWVUVVUUUTTTSRQQQQQQQQQQPOOOU^baaa`aaa`````a````aaaaaa`a`abbbcbbcccbbbbbbccccdddddeefgggggghhhhiijklmnnnl\B/,-../00011233455667678899:::<<=>>???@@@ABBBBCDDEEFFFFGGHHIIJJJJJJKLLLLLMLMLMMMMLB- (O[Z[[ZZZZZYXXXXWWWWVVUVVUUTTTSSRRQQQQQQQQQPPPV^aabaaaaaaaaaaaaa```aabbbaa`aaabccdcccccbcbbbccedeeeeeefgghhhhhhhhiijklmmnndL5,,--.-/0012233345666677889::;;;<==>?>>?@ABCCCBDDEEFGFFGHHIJJJJJJKKLLLMMNMNMNMMMLF1 #K[[ZZZZZZZYYYYXXXXWVVVUUVUTTSSSSRRRRQQQQQPPPQW_bbabaaaaabbbbaaaa``aabbbbbabbbbbdcdddddccdcccddddfeeeefghhiiiiiiiijkkkmmnkX>-+,,---.//011233445566778889::;;<<=>>?>??@ABCCCCEFFFGGGGGIIJJJKKKLLLLLMMNNNNNNNNI7 H[[[[ZZZZYYYYXXXXXXWWVVVUUUUTSSSSSRSQQPQPPPPRY`bbbbaaaaabcbbbbbaaaaaabbbbbccccccdeddddddddddddeeeeeeeffghiiijjjjkkkkklml`H2+,+,,---./00123333444567888989;;<<<==>>??@@BBCCDDEGGGGGGHHIJJKKKKKKMNMMNONONNNNK<& (G[[[[[[ZYXYXYYXXXXWXWVUUUUTTTSRRRSRRQQQQQPPQRYadcccccbbbbbbcbcccccbaaabbabcddddddeeeeeeedddedeffffffgggghhijkkklklllmmnfP8,++,,----./00123333434566788989:;<<<===?>?@AACCCDDEFFGGGHHHIJJJJKKLLMMNNNOOOOOOM@+ #DZ\[[[Z[ZYXXXXXXWWWWWVVUTTTTTSSRRRRRRRQRQQPPR[bdddddddcccccccccccccbcbaabbcccdddedeeeeeefeeeffffffffghhihhiikllklmmmmnjZB/+++,,----../012234343445678999:;;<<<<=>>??@@ABBBCCDEFGGHHIJJJKJKKLMMMMNNOOOOOOND. BZ\\\[[[[ZYYYXXXWWWWWVVVTTSSSTSSSSRSRRRRRRQQS\ceeeddddddcbccddcccccccbbbbbccccddddeeefffgfefgffgfffgghiiiiiijlllmlmmmmaJ5,++++,,---.//001233433344667799::;<<<<<>??@?@ABBCBCDEFGGGHHIJIJKJKKLMNNNNNOOPONG2 AY\\\[[ZZZYYYXXWXWWWVVVVVUUTSSTSSSSSRRQQRRRRT]deeeeddddddddccddddcccdccbbbbccdddeeeeeefffgffghhgggfghihiiijjjkklmmmnngS;-*++++,----.//0011234444446677899::;;;==>>??@ABCCCBCDDFFGGHHIIIIJJJKKLMNNNNOOPOI7 @Y\[[[[[ZYXXXXXWWWVVVVVVVUVVUTTSSSRSRRQQRRRRV^deeededddddddddddddddcdcdddccbccdedeeeeefffgfghhhhiiihhiiijjjjkkkklmmnj[B0****+,,--..../0112234545555678899::;;<<==???AAABBCCCDDDFGGGHHHIJJJKKLLLNNOOOOPJ8 !5AY\\[ZZZZZYXWXWWWVVVVUVVVUVVUUTTTSSRSSRQRQQRW_effeeeedddddddddddddddddddddcdccddeefeeeefffgghhhiiijiiijjjjklkkkklmnlbK4*))**++,--....//01223445455667789:::::;;=>????ABBCCDDDDEEEFGGHHHJJKKKKLLLMNOOOK:"4DY\\\\ZZZZYXXWWWWWVUVUUUUUUUUUUTSSRRRRRQQPQRX`effffeeddddddddddddeddddeeeeedddddddeeefffggghhhiijjjkkjjkkkkllmlllllfS:,)))*+++,--..../0111233344556778899::;:;;<=>??@AABCCCDDDEFFFGHHIHHIJKKKLLLMNNOL<"2DY[\\\\\ZYYYYXXXWWWUUUUUVUUUUTTTTTSSSRRRRRQRYbffefeeededdedddddddeedddedeeeeeeedddeeeeffghhhiiijjjjjkkkkkllllmmnmmhXA/())**+++,,-...///011223333455667789:;;;;<<=>>??@ABCCCDDDEFFFGGHHHIIIJJLLLMMNNL>%0CX[[[[[Z[ZYXXYYXXXXWVUUUUUUUUTTTTTTSSSSSRRQTZcffffeeeeeeeeeeeeeddddeeddddeefefefeeeeefffgghiijjjjjjjjklmlllllmmnom^G2*))***++,,,--...//0011223333445667888::;;<<>?>??@@ABCDDDDEFFGGGHHHHJJKLLLLMMMK>6&.BW[ZZZZZZZYXYXWXWWWWVVVTTUUUUUUTTTTTTSSSSSRT]ceffeeeefffeefffffeeedeeeeeeefffffffefffefgghhhijjjjkjjkkllmmlmlmmnndN6+*****+++,,-,-....//0001233343445678799::;<==>>?@@@ABCDDDEEFFGGGHHHHIJKKLLMMMK@* 'CX[ZZZZZZYYXXXXWXWVUUUUUUTTTTUUTUTTTTTSSSSSW_ffeffeeefffffffffffffeeeeeeefffffffffffffghhhhhijjjjjkkkkllmmmmmmnmiT<,)***++++,,-,........//011133334456678889::;<<=>??@@@AACDDEEFFFGGGHHIIJKKLLMML@/ @Y[[[ZZYYYYYYYXWXWVWVUUVUUUTUUTUUUTTTTTSSSTYaghggggfgfggfggffgggggffffffffffgggffffffgghhijjjjjjkkkllmmmmmnnmnnlZA-())***+,,----.......////00122333456678989::;<<=>?>?@BABBCDEEEFFFGGGHIIJJKKLMKA* DY[[[[ZYYYYYYYXXXWWWVVUUUUUUUUUUUUTTUTTTTSTZchhhhhhggfgghhhhggghhgggfggfggfgggggggffggghiijjjjjkjjkkklmmnnnnnnmaH/((())**+,,,--.-../...///00001233345567889999:;;<=>>?@@ABAACDEEEFFFGGHHIJIJKLK?* F[\[[[[ZZYYYYYXXXWWWWWWVUUUUUUUUUUUTUTTTTTU\fihiihihhgggghhhhhgggggggggggggggfghgggggghiiiijjkkkkjklllmmnnoppogP6)()))***++,,,--...///./0000011123334566789:999:;;<==>>?@AAABCDEEEEFGGHIIIIJKJ?* "H[\\[[ZZZZZYYYYXYXXWVVVVVVVUUUVUUUUUTTTTTTW`hiihhhiiiiggggggghhhghghhgggggggggggghghihhhiijikjkkkkkklllmnmoopkV=*')())***++,,,,-..////0/00000111233344577789:99:;;<<=>>>?@@ABBCDDEEFGHHHIIJJI>) $K\[[[[[[[ZZYZYYYXWWXWVVWWWVUVUUUUUUUUUTTTTZcjjiiiiiiiiiihghhhhhihhghggfgfgghggggghhiiiiiiijjjkkklklklllmmnnokZA-()))))**+++,,,,--/////00001111223344445688999:9:::<<==>??@@AAABBCDEEFGHHIJJH>) &N\\\\[ZZZZZZYYYYYXXXWXWWWVWVVUUUUUTTTTTTTT[ejjkjjhiiiihhhihhhggghhgghggfgghhhhhhghhijijiijjjjjkkklllllmmmnnl\D/(()))****+++,,,,--..////000101222244544557789899:;:;<==>>???@AABCCCDEFGGIIJI>' (P]\\[\[[ZZYZZYXXXXXXXWXWVWVVVVUUUUUUTUTSTV^hkkkjkjjiiiiihihhggghhhhhhggggghiiiihhihiiijjjjjkkkkkkklllmlmmnl_H2))))*****+*,,,,,,-../////00001111234455555667899:::;;;<<=>>@?@@ABCCCCDFFGHHG;)$/R]]]\\\[\ZZYYYYXXXXXXXXXWVVVVVVUVUVVUUTTTYbkllkkkkkjjjihihihhiihhihhiihhhhiijiijiiiiiijjkkkkkkkkkjkklmmnnlaL5))))*)***++++,,,,,--...////000012233345555566778999:;:<====>?@@A@ABBCDCDFGGF:$ (4:T\\\\]\\[ZZZYYYYXXXXXWXXXWVUVUUUVUUUUUUTU[ellmmljkjjjjjjjiiiiiiiijjjiiiiiiiiiijiiiiijjjjkkkkkkkkkkkklmmnmeO7*())*****++,,,,,------...///0011112233455555666778899:;;<<<=>>@@A@ABCCDDEFFC7"AW\[\[\[\[[[ZZZYYYXXXXXWVVVVVUTUUTTUUUUUUW^glmmmlklkkkkkjjjjjjjjijjjjijjjjjiihiijjjiijjjkkkkkkkllllllllllfS;+()******++++,-------.....///0001222334445556666788899:;;<<==>>?@AAAACCCEEEA4 ,*BZ\\\\\\[[[Z[[ZZYYYYXWWWWVUVVVVTTTTTTTSTTYbjmmlmlllllkkklkjjjjjjjjjjjjkkkkkjiiiijjjiiijjkjkkkkllllllllllgV?-())******+++,,,------../////000111222344555667677789:;;;;;<==>??@AAABBCCDD>0 &J[\\\\\\\\[[[ZZZYYXXYXWVWVWWVUVVUTUTSTTSU[flmmmmlkllllllllljjjjkkjkkjjjkkkkjjjiiiiiiijiijjkkkkkklllllllgWA/())****++++++,,-----.....///00001122323445556676778899:;;<<<==>??@AAABCCCB;+  0K\]\\\[[[ZZZZZZZYYYXWWXWWVWVWWVVVVUUTTTTW_immmmmmllllllmlllkkjkjkkkjkjjjjkjkjijiiijijjjjkkkkkklkllllllgYB0)*******+++,,,,,,----...////000011233344344456667778899::;<<<==>>?@@AABBCA8-" *N\]\\\[[ZZZZYZYXYYYYXXXXWVWVVVVVVVVVUUTUZckmmnnmmlmmmmllmmmmllkkkklkkkjjjkjjjjjjjjjjkkjkkllllllllllllhZC1*****+++++++,,,,,,,---...//0/001112243444455556777878899::;;<<==>>?@AAAAB?4# 0R]^]\\\[[Z[Z[ZZYYYYXXXXXXWVVVVVVVVVVUUUW^gmnnmnmmmmmmmnmmmmmmmmlkklkkkkkjkkkjjjklkkkklkllllmmmmlllmmi[D2******++,,,,,-,,,-------.../0001112233444445556667787898899;;;<<=>???@AAA=1#;W]^^]^\\[\[[ZZ[ZZXXXXXWWWWWVUUVUUVVVVVUYbkoonnmmnmmmmmnnnnmmlmmmmllllklkklkkkkkllllllllllmmmnnnonnmj\F3+***+++,,,,,----,----------./000112223345555656667778889999::;<<<<>>?@@AA;,$BY^]]\\]\\[[[[[ZZZYYYXXXVWWWWVUUUUUUUUUV\fmonnnmlmmmmmmmmnnmmmmmmnnnmlkklllllkkllllmmnnnnnmnnooooook]G4+*****++,,,-,----..-.....-..//00011233444555566667778899999::::;<<<=>??@>7( ,I\^^]]]\[[[[[ZZZZZYYYYXWXWWWVWVVVUUUUUUYbkoooonnnnmmmmnmmlmmllmmmnnnnmllllllllmmllllmnoooonnnnooopm^H5+****+,+,,,,,,----......././//00011122344455566666778889:::::::;;<<<==??=2"  5P\^]]]]\]\[ZZ[ZZYYZYYYYXYXWWVWWVVVVVUUV\goqppooooonnommmmmlllllmmmnnnnmmlmllmmmmmmnmnooooooonnoool]H5,**+*+++,+,,,,-,----..../../0/000111333334455666777777899:;::;:;:<<;<=>>:. #:U^^]]]\\\[\\\ZZZZYYYYYYXXXYXWWWVWVVVVVYblprrqpppopoonoonnmmllmmlmmmmmmmmmllmmlmnnmnnonooooooooonj[F3+*++++++++,+,,,,------....///00001112333344455666667777889:;;;;;;<<<<===6) "C[^]]]]\[[[\\[[[ZZZZZZYYYYXXXXXWVWVWVVW]gorrrrrqpppppoooooonmmmmnmmmmmmmmnmmmmnnnnonnnnonnoooooojZD2+**+++++++,,,,,,,-----...////001011222233334455556667777888::;;;;;<<===<2".M]^^^]^]]\[[[[ZYZZZZYYYYYYXYYXXWWVWVUUXalqrrrrrrqqqqqqqponoooonnnnnnnmmmnnnnnnnnoonnonoooppooooiXC1+*+++++,,,,+,,,,,----.....//011111222222223444455566678877889:;;;;<<=<=8+6U__^^^^]]]\\[[ZZZYYZZYXXYXYYYYYXXWWWWW]gprrrrrrqqrrrqqqqppppppppnooonnnmnnnnnooonooooopppppppogV@0+**+++,,,,,,,,,----.-....///01111213223222333444555667778888999:;;<<<=<4%@Z^^^^^^^^^]]\\\[[YZZZZYXYYXYYYYYYYXWW[dnssssrrrrrrqqqqqpppppppqqpppooooonnnnoooooooopppppppqphT>0+**++,,,,,,,,--.-...///./00/000112222333433333345555666777889999:;;;<=:0 (L]^_^]^^^^^^^]]]\\\[YZZZYYYYXXXXYYYXXZ`ksusssssrrrrrrqrqqrqqqqqpppppppoooppppppppppppqqqqqqqpfR=/,++,+,,,,,,----.....////00010011122232333333344455555666777889:::::;<<6( 5U^^^^_^]]]^]^^]]]\\\[[Z[ZYYYYYXXXXXXY]fquuttssrrrrrrrrrqqrrrrqqqqqpppppoppppqqqqqqqqqqqqrqrpdO;.,,,,,,,,,------...///////01011222222223334344434455665666778899:;:;;<:1$(?[^]]]^^_]]]]]]^]]]]]\[[[[ZZYYYYYYYYXZblsttutssssssrrrsrsrrrrrrrqqqqpppppqpqqqqqqqqqqqrrrrrpaL8-,,,-----.........////////001112122323333344444444555666677788999:;;;:5'# #)M^^^^]]]^]]]]]]]]]]]]]\\[[[[ZYYYYYYYZ_iruuuttttssstssrrrsrrrrrsrrrqqppqqqqqqqrrqqqrrrrrrrro^H5--.--.....///.//.////////00000111223233333444444455555566777888::::;:8. !&9V__^_^^^]]]]\\]]]\\]]]\\\\[[[[ZYYYYY\fpvvvuuutttttsttsssssssrrrrrrrrrrqqrrqrqqqrrrrrrrrrqlYD2--........////////////////00001112222233334444555555566677788899::;;:3% 5G\_^]^^^^^]]]\]\]]]\]\\\][[[[[[ZZZZY[bmuwwwwvuuvuuttutttssrssssrrrsrrrrrrrrrrrqqrrrrrrrrqhT@0.....///.//./////////000000000011122233333444555555666667778899:::;:7,!'6R____^^^^^^^]]]]]\]\]]]\\\[[[[[Z[ZYZ_isxxxwwwvvvvuuuuutttssrsrrssssssssssttssssssssrrrrocO<......//////.//////0//0000001011112122333443444555666677788888899::;92$ %DZ`__^_^_^^]]]\]\\\]]\]]]]]\[[[[[ZZZ^fqwxxxxxxwvvvvvvutttuttssssrttttstttsttttttstttssrm^I7/..../////0/00000000000001111122122232333444454555656778888999::::;:5**:O]^_^^_^_^^^_]]]\\]\[\\\\]]]\\[[[[[\cnvxxxxxxxxxwwwwwvvuuuuuuutttttttttstssststtsstttrhWC5/....//////0//00000001011111222223333343444444555566677888999::::;:7.  +>X__^^^^^^^^^^^^^]\]]]]\\\\\\\[[[[[]cltxxyxxxxxxxxxwwwwwvvvuuuuutttttttttttttssssssssobO=2////////00//0000000000011111122222333444444445465556777788899::;;;91$8O]__^^^^^]^]]^]]]]]^]]]]]\\\\\[[[[\aisxyxxxxwwxxwxxwxxwxwwwvwvvuuuuttttutttttststttrk[G70.////000000000000001111111212222223334444555566656667777888999;:;94(  =W__^^^^^^^^^^]]]]\\\\]]]]]]]]]\\\[_hryyyyyyxxwwwvwwwwwvwwwxwwwwwvuuututuutttttusttqeS@4/////0/0000100111111111112222222223333444455666677776777888999::::5+!3L]_^___^^^^^^^^]\\]]]]\\\\\\\\]]\\^gqxzzzzzyyyxxwwwwwwwwwwwwvwwwwvvvvuvvuuuuuuuuutn_K:0/////0/00000000011111121122222232333444454555667676777778899999::7-%  ;W___^_____^_^^]]]]]]]]]]\[\\\\[\\^fqx{{{zzzzzzzyzyyxyyxwxxwxwwwwvwwvvvvwwwwvvvvvtjXE50/0000000000000111111111222323233344445555666666687788888899999:970# -L\____`______^^^]]]]]]]]]\\\\\\\\]dnx||{{{{{zzzzzyyyyyyyyxxxxxxwwwvvwvvvvwwwwwwvqdQ?3000000000011011011112122222333344444555556666667777888888899999:80% $AY__^__^_____^^^^^^^]]]]]]]\]\]\]^dnw{|{||{{zz{zzzzyyyyyyyyyzxyxywwxxwwwwwvwvwwul[H9211100100010111112121222122333334444455566666666777888888889999971&3R_`_______^^^_^^^^^^^^^]]]]\]]]]^dnw|}}}|{|||{{{{{zyyyyxxxxxyyyyyyxxxxxxwwwwwwqdR@523232221111221212212222332323433444555556566666777788888888889971& )G\`````___^^^^^^^^^^^^^^^^^]]]]]^dnw|}}}|}|||{{{{{{{{zyyzzyyyyyyyyyyxyxxxxxxwwl[G933323332332333222212222222333334445445555666666777778888888889981'  .@W____________^^^^^^^^^^^^^]^^^]^cmw|}}}}}}}}}}|{|{|{zzz{zzzzzyyyzyyzyyxyyxxxrcP>43332233333343333333233322233334344454555556666667777888888999982& ./N]______^^^^_______^^^^^^^]]]]^_dnv|}}}~}}}}}}}}}}||||{{zzzzzzzzzyyzzzyzyyzwiWC74333332333333344333444433333344444455555555666667778788888888972' =N[__________^^^________^^^^^^^^^cnw}~~}}~~~~}~}}}}}}}}}||{{z{zzzzzzzzzzzzzyp_L:4333322333333343444444444444445444555555556666666677778788888882& '>W_``_`__``________^^^_____^^^^_eox}}}~~~~~}~~~~}}}}}}}}~}|||||{{|{{z{zzzzteR?5323323333333343334444444445455555555665566566667667777888888880$1O^__``_````_``__^^^^^^^^^^^__^_doy~~~~~~~~~~~}~~~}~~~~}}}}}||||{{{wjWD833333333333333444444444445555555666666766777676667777778788885-$ %G\`_________``__``___^^^^^^^^^_epy~~~~~~~~~~~~~~}~~}||}yo]J:43333333333333334434444444555555656677777777788778887888888874+ -@W_`````__________________^^^^`gqz~~~~~~~~~~~{s`N>55544444444444343444444444554455667667777777878888888899899982' '8S]^__```___________`_____^___ais{~~~~~~~~}udQ@65554555555454444444444444444555666667777777778888888999:9:96.%"  3N\]]^^^^____^__________^_^^^^aju|~~}xgUB6555555555555555455554445455555556677777777777888888899999993* /J[^^^^^^^^^^^^^^^^^^^^^^^^^^_clw~~wiVD7555555555556556655555555555656566676777777788888899899999970& 3EY]]]^]^]^^^^^^^]]^^^^^^^^^_`enx~xjWF85555555555555666666666666666767677777877888888889999999::95,   -@V]]]]]^]^^^^^^^^^]]]^]^^^^_bis|~xkYH:55555566565665666666666676777787877877788888889999999999971'  (=S[[\\]]^^^^^^^^^^^^^^^^^^^`enw~wjXG;666566666666666666666677777888888889898988888898999999:983* &;R[[Z[[\\\]]]^^^^^^_^_^^^^_agpy~whVF;666666666666666676777777777788888889889998899999999999:85.$"9P[[[[ZZ[\\\\]]]^^^^^^^^^__cks|~vgTE;656666666666677777777777788788888888899999999:9:::99:9960& "8OYZZ[[[[[[[\\[\\]\]]]]^^^afox~~sdQC:666666666676766777777777877878888898899999999:9:::::::82("!';PZZZZZ[[[[Z[[\\\\\\\\\\]^bjt||p`OA977777767777777777777777788788888888899999999:9:::::::83*%&(;PZ[[[ZZ[[\[[ZZZ[[[\\\\\]_dnw~yk[K?9777787777877787777777777787788889898999999:99:9:::::83*  -9DPZ[[[[[[[[[\\\[[[[[[[[[\`is{~ueUF<87777777888878888888888888888888889999999999999:::::73*   'FSZ[[\\\[[[[\[[\[\[[[[[[^enx}{p_NA:7777788778888788888888888988999889999999999:99:::::71) -BTY[[[[[\\\[\\[[\\]\[[[]bkt|wiYH?98888888888888878888888988999999999999999:9999::::970' .EUZZZZ[[[[\\\[\\]\\\]]]air{}p`QB;9989999998998888888898889999999:99:::::::::::::::96.$ #4IVYYZZZZ[[[[[\\[[[\\\]birzuiYI?999999999999999999999998999:9::::::::;:::::::::::84+! 6NYZZYZZZZZZ[[\[[\\[[\`gqzym^OB;9999999999999:9999999::::::;::::::;;;::;;:;:;;;95/&%?T[[ZZZZZZZ[[Z[[[\\\]_fpy{pcSE=99999999999999999999:9:::::::::;;;;:;;;;;;;;;;;82( -EW\\\\[[ZZZZZ[[[[Z[\_fpx~scTH=:9999999999999:99:99:::::::::;;;;;:;;;;;;;;;;;94,! 7OZ[[[\\\\[[[[[[[Z\[^eoyvfWI=999999::99::::9:9::::::::::::;;;;;;;;;;;;;;<;:6.$ -%@W\\\\\[\\\[[[[[[[\_fpy~vgYL?::::::::::::::::::::::::::::;;;;;;;;;;;;;;;;95.% $ELZ\\]\[\\\\\\\[[[\airz}vgYK@;;;;;;;;:::::::::::::::;:;;;;;;;;;;;;;;;;;:94-# 4AU[\]\\\\\[\]]\\\]bjs}|sfZKA<<<<<<<<<<<;;;;;;;;;;;;;;:;;;;;;;;;;;;;;;:72*! #2JZ\]]\\]]]\\\\\]_foxxoaVIB==<<=<<<<<<<<<<<<<<<;;;;;;;;;;;;;;;;;;;:95.( &  *AT\]]\\]]]]]]]\^cjt~uj\QFA>>======<<<<<<<=<<<<<<<<<<<<<;<;<;;;;:95/(#"->>>>>>>==============<=<=====<<=<<<:61)%%5L[`a`___^^^^^`gnxxn`UJD@@??????>>>>>>>>>>>=>>============<:70*%   #@JZbbaaaa````bfnw{pgZOHCAAAA@@@@?@?????>>>>>>>>>>>>>>=>=<95/)   9G[dddccbbabdhoxuj]TJFCCCBBBBAAAAA@@@??????????>>>>><:61+# 9FZdffeeedegkr{wlaVNHFEEEDDCDCCBBBBBBAAA@@@@@@??>=95/((2H]fhgggffjovzocXQKIHGGGFFFEEEDDDCDCCCBBBAA@?=94.'%  !4L`hjiiijnu}zoe[UOMKKJJIIIHHHGFFFEEEEDDCB@=82,$% 8?Pckllmpt~zod\WSQPONNMMLKKJJIIHHGGGEB>92,$% 'GIWgnprv~vnd]YVUTTSRRQPOOONMLKHFB=704)"   &3:S`nv}wmea^\[[ZYXWVUSRPLHC=5.4,$   %BG]s}umifecca`^ZXRNG>9/8-$!   ?Gk}urmid^ZQKB;393%   4[]x~sfXSH?9?9,% 1&@2JiobsXM9(",*  !2>CIBN7#:#    endstream endobj 110 0 obj << /Type /XObject /Subtype /Image /Width 938 /Height 326 /BitsPerComponent 8 /ColorSpace 108 0 R /SMask 109 0 R /Filter /FlateDecode /Length 26424 >> stream x\uᖪj.(_].fgõZEgv*@ e"Ո @P*'L&, ٘hZi)h9#S2iT4w^`3`g{w~sܹ3O B~,-TEԆBX_-Wkp4[ju:V^+UJՕ+eJjbTUԡ𴢎PEVrEmUjޤVת*_z)rcF,T9WvѤ#Z*3M״HUT@j"2j(ʹX\!yʧK"qXlFӻXJ &=pɁ0eq Y2Am˭aX:[;]vG0hnY9ZųD%RbAVj$ /[Ve[%!@'GQ^v--=pfRk@RTA:=ETXLU7{N\\xZ$WZ׼ ˔.L4]CEj\%’3U :?oP}c{'w֦qKl{9hj$ [J6ḰK;^m[jj*[vZժڢL5K ڙS Q (~"b)U2`5gqRLĬg%&sKV)jçj Ly ߦGny C2PUتqgW/j:l([_1xZ&욒gVW[VĬժ$AٽTGSZ5.2YEqb"Bb|DNrɶPÓn8,o<+=pi" T~CmUE>}2axnuZ^ڨDU^Uj*)۪>P)QuuDj*ea8Y7IyYRFb <7XlYF\Ӭߪ=./е<_C-B]4 ҂6D zn\nS[H"FUnVm+V1U%bsFLHežDDyhI[ Z]¿URyDmqn_yܻbЀ+Hptvi羖qӌMxИڠ`"lzP񴏑v:: hC l~x"v@U|]+JD&(C Wl*B\u"JRZ,hW0kHy1r & B,T 5E-X '|bڧE/z?%_J]+ά:C-uBj՚LS(.]%TK`eܡiotG_3 (h{%V .𠀹z f?{v[ڰ3AiE}LlV*p`Q~ T)[LT5:"dm'8^j$)V[BTjQ/J右@'+ -cs_4d ˆzxVm@ymHQdJV7 mTe).@ܽF#6D% [GLd*V 8LSq2Q+j_}BRJ,M _*V#_dbwfJyY۔vc,+N ųԋ#a( D-KA6uZU1R6e=X *i֍MEKp.W8'ҺVP^S5}#vr3QPפT`rSQ$}r%g';Jy (Wtҽ4Y&[*"1)3YbUZE}-lkXZكz ղҵ9hXf*4 V 7$ךԹ Ȫ.Tg[`O m? xF.'0]=8tvDW/r&F gnGp{d8gnF]>@kD)$<5Yw]ynE2B2IzыDVeUP 1VBCq2*qK3l (“RL5FjKQ*b"W&Eqx pxZۼY)4 mdFMԤc=-ia)1)JRWl SKuh[$"\zr'ϒq\tI-cÖs+;\X%ZVMI<ϦV}C_~ܥ(ݟLZڮ\Ά0uoҎ pV+Oem]ӵJ05՘zP],RZ 7[6M[r~!'d30dZqVCP@u R@GRkR=bPR~uJ~N;Yt~ {+@ jUGS1LCo-v .Om|4Ny>0:3cF.YքdR)03dJZ[F-rը-)5m{W;i`*Sv)ٛ#>*i-Ҵ-ïSIw+M (-Dr3@5=}mӉJnU6ZZR9[n@,FYgV[aGqJΊ4-(rU!MH*4) =lfv%TGedbs>+7(Th[2x|k ggA*E+8R;C`}ݳɚOSDreV3Kƺ_R(5Z( DUU)HD (:VoeD-Fyjx)\5j#Ilbϯ$Zg6r#ؕ+ z.=P QE74{}j]1j`eTɉ4}WV0 5v7Ph S5+uk[uv蘟FMM΃'܀}FN}`>ሄ_./dB}Y( @fy4);.Ee޷J kO1A%UʯnPQS%ب U3qΔ_RlLA VM5]kGj俁<3+)JjMcTpY7L2#i(6(Ϸ%+Qmw;}7{8K 4𩍃4 BUGMUDUj:[-A { rYZUĶ3*BR n(|-d.ZkkU>zDT[oYs/;/ܐ=PnEpy{MTi,= 34T3*"ޠ4yh@L2J*sM\(Q [B(*.I NM#ܠzYݨIX9g|G-jIjp5=ݤmYԇ~jSpm_㸪E%(埡 z[x(i?!ݷ\m{+*Em%{/Fg-\X $?PRisܶLiJذ>\VH{|!3a"~,9@~]ù?n.Uu84=X1 G,)5٭FS:]#U~ ~E*f7(BU`ŘxXKEX У)j&' ݍzʸSS)Gp:e#5X(N u HHӍfZm4ЊJ*=t; Xe blZ=gNXa=U6RMo.Vb֡M'_w|š~@s\1)Dە6(+`Ub t:4npB j([K| @ܾ(QBֆx0$ʹhkf PC0s-5 yL d. Śp FucM Uoͭ#dZ,0PxJݚ)5kfp(^+^@Wgjmz^[qE@ij ܨb\KeSnb٪Y 8k3O稡d/FTyxä{-f3O )ƋdMeMIl+m6;vf0iňNjB2rt&mumk< {e ܵ$Lɓw 0*q@(_p~x l:^[ur?lج[(V&D呧ZXcܽ':bqf9͊hzFγbv8Ps1(Ă3aiy&vj>n+}C6[^{ (# UcjC*U(RxTW!EzȥO`| p k 1&l(->(ŷhڊ!UϷxDK1u2"R<j:hM IщP_|,\Ѣ4s*3ASyHjP!VPot]J m#Ru/]lmFtU:xs;r.Ag>39WhfZG(d,ݶ]mK(h{m=IBvDOHSDŷZJT`W&R/%'k$O{sBAGsq ,Μ˙Xf$#YOn v.X2c\IV[1+[mZJXMPkKR Fw5b΋p\H7 E^,߰x{ۄH*jHS%j/iwlOk>^q#,ׁ}҂p3 $HaGfzA;m[ouLJTtl oE*S7_Z8t78|2gyD.8Օ2iMpggdiwF*"vهMP$Q+ՌezBTQC4Mj ('uGC8Ml2pxY  ̐qv**fbY2 !'djR 5J6J?Wmۅ5.Let}z¶$]羻}j͍偳1Q.tOByrAh:t*xiIJ.V[ׯGJUL~ OuU[-N--Sl:y3Y2ɘ.|L0n`S|Jᩖ2P8bC ;UWl'UJB:Ul֌yZIn~?%?Jq!_*29&1VYD~AO<?E=ˢ'yz`5Ze)DixŇCԶr'4t* MI tW`L+50- } f[0SsNvx6qjF|jݞɇԛ8;`3yB Tϻ;`S:uv8wRTNs}[n,^M1Q>FMȧZ>Bi!4+ G.}ybOH6=MGmB8<oGvjR4N6([ k)>!ʵ7:֨qepRQLNK5rޅV(5RlG1+P43kXy(mHUnM 8o2r$SEڪ,,i!K£ϯK)I!7kX6MKha)lK_)9 Z8TZvHZ vm*6u}Owbݠ\8@I y2A2 ())llFWzm]IQuCs iy5Z Sd۠*VjﺵmR$~{|u`F[%_dN֡if,mhi5k: y͠ojsSpS[Sն%-%6:ĽI+=erNfJP84th3Ù&lU aiEc8ўEWG["Y038ܑHn=p~x5ngb*} RG͎9%βتAVks;Vg {0hWyvhj'f''%|  ̹)8@/9L{_Vzqdy,-l7

@-|=8@;́2l&(lOuIn+ Aۄ9usaB*?ވIG$*꼺2\ lMO7[a$a͇8sY_YFDk4M4Gn)X $=GUAȭV |m JzL]I6zp-Ud7\I[`yRCZnvH zVaSģaVk)lR:y ݕNQ|k <&-P Q6#N$'E{&UxP$HgSr2t$v:öYߠl]FRYçt7;gSy [k`)7gh@šohQs|qn+3UPD .fB-mR)|z&~p-:^ѹxz&Y z&ݣPwK*ϬMAb s%iK>XqUR&jҴG) HmV9VlQΗBV^-V{۽ȸ+VY `*H (׊Ԅ$ Cpf=0L0R)d/|n%VAjYЎ'wȹT' q_`>\ҩ!ov/8R{Xq4ms9xz.$φg`eG :9M@ȇ(kԡD CsLm1+ M!vOv|X/m<.wO9w3/p5 34(ժkUH$"NkdKRQ*~_ @vGFsȦ p:I2\'og[f8#NRr=QD^rTs 1vך9:wMY{4P=l,TnS&dG4f(  :Z1N#<<(G ^ffLm**S*)sbD*-ҍ[{** Jm'ԃ5@=,NTml7fO[XEJcת_"_ %ե*Ys]Uq NdFiMJPS{ kSN4|qX&~5-09%G pvM|gQ'*NFqb3ـ,3 !q&UYccCFIz׹<(;A8A假|G.;ы!!f;?~47l@VmCov=Vud;d"Gӂ^dcʳ6''ܚOk:=߫%PT9x]RiC-Iiq>_gI c_iy::d^j|c kWv a{5تz0p ɽř%5ݣN@sS/ݵ|Ч(/ 0M4tIJ%ق=^„RN>ةPgꃅO)=? Og5H.=0I xx@þ@Qƌ[zBz|bO* FK5 ^/=0!֠~bqt лܝ<5dIzHrhN၇ 혩IʦS[܅0n46Qb'3*bpJVAPo6TcCGt6yW1_8iN끇 %jcU{ju!Ĥf˴#Ej](>!RH.N_S΢ۊ }]]s$\wn+O\˿#Z}+<``i $Gx |\ hBC[^z$W͹ ]DRV vmҰߓmFVӗJ`93 <ދ9?fr8Իq_61.=@.`"DfEb]Zb"&9u̵FG(MC3$ʴ!CO] Uf; WEkjLG x)ۃ/|mZKԄOj;>^|S00Q\HN?xգ&@!catDaw9pFjK\1~L%#<>C % ZM}cK'PvryKTD'Sqǒ"MYLEҎۨ98uT< AY+u¹fu26;exE )JaL'iJb0̮0rT|bj$ົkm݌ֵe #o?}AlX1Y$c_0-O[Z/԰Y{sK-Dy| {P|N!nDحXi:Qg#čc[OIJ@'I?3lvroڂ6}ȋdFN^"4EF+"ER}c("&H昙Ā0M[gT(?E Y^l?D-J;O %hڵ\M-Q] W>oLGH~r6ai`% ziB`]I<+{aHt_MU,Jy-*_z!/}]ycƙ͖@ -Ǒ%Teh<>5UDl%Q^". Ky9'k7gT`Hu TXEM1*Az-H-)sm ^WaB8obgWcҍ kx`L01n)pՐ'n$z`@jmKuwGd2?zbyzB2yg_qG-~t_,`?x`b]6 $MN&$n{━=K$l$-9m88#XS69Ip=ّ&@$㫁Vt^D:=*[jjQ_0L i,B<Я\&!kDk`=ЫH#|DZK#<l9'J`:~33x:ـSR#( bJnPN~.Xb=&C| QNib㤍ؤ~'Z&3n]7$3/XT5q"!˧ͷxS23z~HO@>t8=VrC8-X;|՞rXF{8.4CN^RU?'Z1eEԜɌyt@z##HX _R|,MY=/ y/e^D~^pJ Kc}W~jα8 0?Ǚ/=0'Ж]@%&g+mҼ1[.K,u>{'gwg3a&@N.ϕNEnp.W=yL1eR~vټJ4`p&\Ōx\ƢHA;sx'IwM]+ $AܞJ:01%)jM M& Lmj m)اZe6ʯ\:/>&"'nU]ql[-)~rR<#s7$_zc7SJ0y*%yqmY<}R\@I23e,J~/$JGVV#ܽr*`k]y<71YS\&>4S,XJ@KW-{$J199E饋.]?)^Y#'OII .c $䩨@2 mW0ذݶ9IOӐ&)O/^tl㌮+M p8%p38V,a=+ad PZ\pZymJY - Pܼţ4a>M Nև6Q=6~2"+,8m" Q@ҋ${3'tlK2=p`W NEyT@=BVփPn_ዅ/aT(6qbd]KԳ/Hj;QZk/%vMJ*vw㧉<估&G^S1(Yѭ1ԥ LCL $6#}̸{~];!)IhiqR{Y3͝>y)J1>)ӟBJ|z9E8=Ld&ZNh*I&|.\M}< guZ"^% axM$]+Du]>D߿+=piK:s0TYؤKʌfrBҹsQK:Sjﵗӳ"@e"8i.~s`$W;GZ?‰r&mW2i6Oj8bj-xʻam Y&hCMpqMo|k>qT[˛H̽(Mܲ{ N&$uG㔃f.L_~5YP8<4\4$K\כx@f -u횡$N& u03ŇV&jR%+Y->$IyAu!*n׶[(Mfvd%G#K\r*Tu7SqSc[N3gIdJ+G*ҹ %LS8Q,5MXv-FT+)bj|OzCĜqܷTg76#t,)ǫ%L4s6PL:cnOrEU8͚Ժm 1E31@ҁ%KK(Ԋ0C5S/]J1O8jT^YhLƝ2k{rgW*'*DL_ #)I3xYF5U qc-aHJׅm}uW\ZPIvHkz]fȗ찿!ÓSF.!y*0 W])DŬ$T#nurt3o귪[cM68ixh 1rM8@lXjnĢVw3Czzi:}Buc"5qX;ox)\xdM-\3 `Nc`Ч9'|4RT^z3Ë4=c? @-(h׃3#Rz>\p{Nh_[Z1xȋ}r88sdnCY!g<ԇ{PwͶNƏ4BTs~@^f_ {݇V\Z4d@jf$6s>J 1miv oM$|%8W:;GZN"+6E,w+.fۜIa*3ޝp3}=p΁Sz5P(INKX4;ړ'C_Eۻm|'Ӻw vGb'5 Bl3*h!\mAտ>Bu3b;7_ wGY }8`:F5^ ohs6\i:؆Q3v$5v4D_tM}S \<2`h܀q`& t>!S}Wް4j{΍ڡh3w{wꁋx,Pk Wh9*bj?ImBmT|cI 곷{ܷ-h%$\l6֦u[,'e3zw+.ݱkڰK.iu*&?ξz.>p$oo ++6<39:S3b߹eգc\t}G± ұ@bHqTQy ]T_kztmƙ/=pI t_Vx\$wH%Q S СTdR\Ƀ!2Xk_+~*@B $udoZ4eTzBtuxlOw]d<8D|ORtyt{!ﰄ Ć@ƍ@ wXS;_TsnFe>ˢy k|" x# |ZyC+ gرC2/F$% ˯}XYC))3qEPWZxdd8WuY3Vǹ)HIW+˳@aEl>ګs D= 2mmQ4"M/PhF:^m=L,Z+A{r>dd~|p>R]ɺkz1%$拙"&A2NpyMZlNV$NY=8cӘej˿v/ch:[M #jVC%@Hw[)lN[q/tW{#)znPxk?N2˸:gdE 8Ç|d@-7YR=PѬĦOVnMd ĵ@d -פ,8Pܑ@8 MY/V=pрcN"@rxFQdy( DR0X`H Â$kcq)JRGύFdވ,J\cyMzq6J,:]߹ )rLR1+44ĵ<a|ồ̪d@xMzChz~t44MSi@Ɂ3x́܏z{O~./ 0!Ė(I '磤EWoM}_g_ǹ@ybqFJ'3qBGbp5?񢒦 &̬y=8;ׯ>ͯvrj k5HZD6#l/$+7nͨ#xH~ٗ^;.8hBk] xC󢑝Ii4{Ycgᇯ=7Ǐkb``݄d:Ϧg~Yyqð}sa(#̭pJNXzW6OcExn>ʟ W1P[zo9~jdJʺdsϦ{z-Ζ {N=ǾpW^+R7o@ z]ʞ}$nӔf[2cOCK{B{ _|WDڼԍ˜FI܂8L#Ͻ9{wMr+xz'~K}oܼݟn2e"_;tyꦟ./3S(y^54n'H|z޸Գ~ggd|t'ʓ7OdA8@ /ƥ祔K fC~wڣO~)XogN[h.4LR؊^y565QzZ(GsL# p_{ɧ~+|;;%kf;w*q$iBҥ771F'g@t=j}ȓ/>/W#jTך=Mg?x>MM'g,7ؙ@Xz|p~_7?|WSO޷n8|6 P*eJbS7l V:eޕ9w(j=p`FY*|J}QT) UJxd N5>:8ݻ fshwzdH;cj`LՓZ<\Yw< (wևbJDzPJbޮ։ߛR^Z@zzcqȓ™#ZBvٙ]<^xc!ͬ7{&{]_HGR*c5[1 Tޕ'^y;FבSޓ3G ,pT;Zjoxom'{,cOy]5iuc`L!gr|^rSۧWdNl~bto2h ,~tR5g'G ,-MWI' ,@o\3/nJ~ẋqh)z6MqZ0Qk{QTwy5v@15xx@^?*ʲt8+`k:kp93*^yx9<qU\m  Pƅ$Kʼnغ?_xǓ/l<@7 (*%ꬻ,jKUapi+T7^|#$fhz|T+70 M4PCx;wY,(Wn;ʸqz',EH30!h{$n0uJ@^v;<&#:<iz ;GлӕUWbihIY聋J",5%2HQ A,?Yb+J̀@<`؝'3 PQ3)dOJ#h&|G)ɮ7A}x@I=BϮl#VU$#=14~Qɗ9n@\t"uqYoDNإ"D*OMc$[/i5Db4@![?Č& ,ةE[|X#7.!)Og94M)(Cm{kO=Qb+WIj?=pɁqtD${It7te+Wa]zy!?!HS 2Je)&;Yz,$w_-GoJOLa{ )c= /%O7-X^bz7_X xFO"bsŠvhDjY ]~yJpz1Z"q2;LDpGxq2x]%}g_y񯓄QF"4UP"1D&8yfsW?wkGnc;ؘ@;΄DJf3L`.+㟽0,k|Ͼz&+=(J9=njC..qW^ ̶՛@#+a.T$˜BpjC$Ͻ'oRz #Nym5`ix}ڣ=cxǾpW^+PzO9!zK==/>?xkb1@Y=R> >'W;tǟxnܼݟnO==p6=rv?_yƓ7n>7gߙ\3wҟK0Uι_{ɯ<wnO'biH.ޕJ'~N๢{zYNv޵/ŧſWV(@Fl?o~_};1Ci1==𐀼J|y+7z{;Y'聇;W駞zwGo]cysJ@<4`FY*|J}s <= tv@> stream x&;.U,[@IΤ Sj!HQB A2WӒ!cU/3 N1?)}?پ?Zy~͞~?IFXD<?Կ~oB[|oW fY`lL]ת]S_O?~Hezz*GH_Ε92~U ~W_m|h?/qyE#~MOr.n/v_|?Έ_ПB_yA*z|~ S~'}CD0<>Oh_ ~f{_|(=G'}&zFe:uX(C`KSɂ? -DI\g xy Yd{XrZĴG-fVDDiOjK"ci_iXa)@29 ӗGOάĜ 33*OsCϿgG&< +|0kMbڧex7fqk7,O}cBcy ƧE3jq'>xEUj*>|޺:E3N|q0h!OJ{6~{>"%n4_Ϙӽk魥6vk$h5ahOa=>kS:wJ>Sb}I\p\-~˜U`9;"OOf._NNݣڧ~eRZOOI>< W_E;:O箪WO3Y>Ժ휃p:n m%\U.{*.Lτ2Sɚ yԢZ^+3Е5WrΚU bk],׶N53`lu*1W`>H>2z#3")J|Dw?GgQEҖ?㞋h;|w!ňKS .볁N\=g2&cٽ>ӹw'?`ʾL1k? #M=oS#HҸZ ltۧS~ }Su,=œżH0{wr^ -6?gS?Cy{>k.n73j挭7T1as&ܘAU~>߭k'8N5KK$\ps/Hߌ3^nht𷀌K7eX;߄ө )&>s`mAKcohBܫ[/? >MnO134D92ci8ﳁ@^ D{`|%!z!69<6Hi@- Qs z92[\5δtk Ͽ4q |CWh7[_4TI~T XEgh\HZ_%,u|kgizM0=[ssK1:`ټg|Տ7&vmΫ_Pc6V5X yI,6,8tbį5pm``:xGGA`8X OW?r{ ڶ،C opeAŧ?f 5'/bLY?FJ彀n ac>Lc23Hf%a> q_G|(7 S }EPjjQ>a!7 \Z dX>z~1OOY_7;] X$>q-S?cqSZ7ϛ.y32hptiQE_^<|]2$mL60Œmmmn`lmq%_Fk=(S %Q6]rE~xm`>fV7}bf%>~yclkmnp{ms$֏ )2I ݔIJv5-Ӿq: D-u3ۜ`u(?b/ mq׀\/VpVtk`I5t,ٯƭ}bFO6w36}XVE#COOc1ۇY̒?wVWOԒujr y.F97Hox8߰Oytb3+ø`<1M->!tW%ͤZ>|+Ć\O3ѿ/I803~ˆ=#MMAs̴"ޟ>o\*:Ԯ&[?ӟ9l3́8x7s^r;1.neF}b6 !rsDl|^wf a&$NpIs^t3^O 46IuMEs Z 2 N:J~0a:pijG& ڷ.J{>I*LvW-%6$ؿS_Y/_xXnցSZL_,1iy` q}wj&O ֧؜lu?>RNu''Ҥ#g6q(RtźپG7cl5cԄ xݏ5vmZdFKOc'/9F=yaxA YKD/D/׹0+viZZ=Rrߏ f;㦵oc/19GcO#(bI#>0񃙭Co4x8Vދ3lColu^v7Ʒ#PCNاl@A(s=B5|'Izܳy}/5`Z>kV&,ﴺ=;b;mskVxU}!th?s!U4\U*.z_ixj^i~4JCOua V.ªp3o4P B%K.4Pg^YK@\Yƾs5٧^{@^k=:ȹ*xv<6/э˹BCʹ*ʻՙ ^4|6  Z*_hg u j,I!691j&<4 sfMK-xS?N:|``^XsrqU*IDT_Oˠ+ a`Ǹ~/\3ӰMއ:+*[Hk`r\Z?6MŠBh߼z@`mqۂԵ2oٻ4>O:HgJLi0yBJlZݖ2bG[%mpe ޼@Y^FHx5){./鹎ɗ~,gv 0ywʗ8f3G {S'v _/0EjJ}.U ?-Nd@0bEz.>̬_ZrCF T&=o5{>bbeZh12`4_٢=\/ƆEϟ]hI0㬌 ؘ>1{e\ t,L_BXY'17EnX9Fgmo^s12놸0<{9?pO>?9GVoQX9->O Cv,J4>[6hCLUj6v{?ʀ oe2`c2Mk+FT2r x*>S Ǩ O[Y@e`CmXj;" z3mw@+|C03%8ٮ, PNzV`<:ۊjA8Kpa"lKȷi +- ͙G01vz=[oc4=NMHjw!pM*/Hۤ]y\pߋl*u '̺t¤|\sA&&7waA1kA<،[\~|m>qݢ=7gXt;< Co(7R0-q3qj1t0uԌ^j93c.f }2G|[y1 P1}&cei!nc%%U^ G;Tp*5dsKEs)|l.mp֟;xS Y< "く(aLt7ۍ.wO&E S<,ކ71gU|Po>7ʽىr1CM٥s8xc]-}ӼA˭T>JVUk>>()b>NuBc }8hg#r}R"b]}B> ~c̙Re4.M} Jthy/_J;>>sAph}A?=sm%dDocĽS>{OnM>*H`>gw>Ab~K0- Ѩ"b^/"YE>+((("pv()^x ZzC"!DNu]4 oErlKmvfܒHd)ڤ^䏿OVmbf_v`/WF#彊D}6"bsU= AbƕCu~eF Jfc^ IOo=<ó3wM`"l&֖4oXu9ĄycpAAK8{ I$jɚ$TW|B$[:s-b.ҵKH94{ɣv4C WHKtsw.3(^b䊛w鑢R>)Ζn@߭Ӄ9jWv7<o݀)NN[n|怗 a'cZ$ ^,Zwv7tk )RkUn6 LHyLA`07oq-Mfm</&^/{({iu &LW>Mώl鉪S^>r;ub;Bks8./c}m1G5|8JQmF~kpj/y1)\wfP#[-0-NnقIo\h)m\8^ʅ@`YpC:8LF"8#u-Ŋ\V#Xb).nRKyH:XtbX %V%V8.Ay0b":bH? u{+&YOv}υRfwYDNrFgojjeA@e5eyX/IHXy^!e?yW/`zi>pMu%؅Ϲ 8Pa i>yl H~= =.HEz.;oOZG>|gJhy|iLOِBcyIk&:>}T#b ZNL19bAߚN<+c-,k wCV"һ(u1qjjs90PצUu ?ӥ'm[C3-#sP:?\WMD{dZs3|r֘sj/*d}CTKtpďŨާk$sw/E9xQA ]s\F.τ;v ?'.s%&o}sey.hfyqDh~A8=rz|<LFy72yty\w3{ypƨJ㟁b\g`ciTmDž݁[1<πg㟉i'aŧI°fM5K?/~4__rr/Y&u g5C!\ˁ71yo陽'pq )ˎNseb;Y 42 ${ۓFW K襪 $T"fʔ}2p7%Ш6@ #螛Nq"HpY[">S~XciOGi>pXalkϩm>Wzj.LO<=J+26DH?;0vmi=0;l{~cS6 lqd +}}cz}`#ol<ߵm>ql7,YK/ض}m>Sۆ} GnG3L c61~P^&@d.L&>>]Lgk'p8pԻ 0u6[=mn8``E>n;,aZQp5)Rݫv8.p^׶NI7x ϧhZ&0[u9MoӔ]ыA6+/0&ğ1R3w}eOYPwB,`-78n kpzt"_>A,c O Ko0 ︜=`s+#YjlqQz4WIuy~EIcK{ TA` ∍Χsa?SbSaE: svz_KYI* S$b@BgٚFyCAXiYE[0tTc5U3·zQ,=>|`܏L1:d~O 6>P_l ^J#1bLQAcLG0l&JLM;iͰlY$mTfaI\KoX7DI^8E\nCUo2W 2yVSYhPkvKn)_g&kEUzސUB|"se. ǸzzaƂpEhz,Yd Zs K xOŅ]o( OK׃zS4z0ς܄:K632,-y{[Ҟ=cl^`h {OL).}9}d^װgn-5EҜEWj G }wiϡ\{BkmTT!cz(3e8G H]nb(z4Z:ՐYUT&;rM#aw_ڤ[EŌEv"I|kj]Mdؤ񘔥561䳩]OsEQ{s GjN{a]d\n!Q~"0Q7갏HYQZUߋTScwZjcCXaUї"ZFu1S򏗟fPL;F[ I:}×2Dt֜"RLS:~]tÜۗ)'aJo$ϩyE#^5 l)?F7?dbFi IJf.䬪P;A6|-O9;.+NDz6-I̪(XB'+ _Umvf0rLbY[͋J5_k+V'MAW).Aܜ6hTj$_9䵈MǿgJ0k a`b?9-MHlTəE|KKquTK 30߅B !3ʕZ$b3Jw*R7VQ*v s:;H5,ʓN^EA ||yqp/zĢ>E\fk-[Зw\_? Y}i1n|=c|aS$_\\EwRyâA-j1kzI΍.yijA`7EjvaNoii9̀yY/2l%p[(:U+e,BZ(cfұ1ّ!A^ےavnyDlx0,[S>هK:Ec([jZ_z^~䭟W>W텡|`vI]0A4쩹U]uPT;5 F㲴b+n- 5 K3:̶| 5ϻ-Tme?ouɷЪ>htWY`ˆ{0cP_G$!Q( q{*ޜrXE:X>? Vo1m]I@7s*h@ͪ0谐p{VoX_!3m+_!ڲU+.w^k Ob^A\v4|PзLN„Aܟ%MѮ]6%K,[SLFt1eܵpL<1ʦ0gJQ%X90\aw.ӞaUkJJqsqLJ&[Nf^iU3Vb2f 1[ &.!&Peil?¬*qW:eZ ݒE9= ICx\طߖUN9dgVy昿@D\|1)t5plEdHO(EOȀ'q}%"Ddg-1׍-gd,/հEf6gIB`-A1oLfQT8g۳|JɢpMuaX8 fdQGQ \k a)b`uꃯ TEָUjudm8@rBZ S-ӭNg75_Bb-|p WL; w+}*>@gT_3v= V`D=ֺQ8-G3NJخU*jbX5ALkoDl"{\\:0*1쌺%{ RQ~V6X>ڎ'$(7=j”).K`.Kt˰\HVEN_-dR mܼ."x\z%90yB;!a_((;.1ކEIޮ\R} n\,' o׍Y52 Ό~_E9+5fS:W&|LdY\Z;LT x˻EbC.['V,pߙ;sc|g ܙEuig%`/QqWf2AYkhyee+^ue^^e1jߙHCivh^ ށ m8ИW" H/ހbM}aTTYQ]ZXUQ֘6T|X'fdVi|Td?wORf2~G/LV [zȚ"Ȧ=]c 13yX< |TyvC#?w=ڵ}3P( S|FNEk^'^Dn+Mi빮 ][ePǥcoå젼f8XZJ&<7Dx"0[*ky4R1Q)ݼϪj˳6(מU Ee= \VUY82OkWEQq%\xq| 6̵8kO #ʟ #p̩P´ /bhQ2P %= ]g5FKQ%W\7+3pr<(=3mssRxCڷS/VP)P Je֧Lr5B0\KDSXdy}$0y϶_|#pBCBΓr".[z6ˑ^%6ƒUv{eeNוUէ$qZEkҥՄZ={2wOXův{1KL3ۖBj; Zt6dž/po&m(y[]7==)-VAx^2CW8ig%2șmzּaVC&oh>Jӯ|c'q>]YG~c|鬟DX>ꇳQo2Qzqz8%z{8V;94}ԣe/[s#oQ(ZYyO c?`j>1e< 9qalQO.}_|Yɣ_>ݺzr%Qߗ2XLrzDʽEU%Q7aV &?.Rpq]HLOzlTc>zNw0㚰}ous_eI|cs-G}_LIzA>}z<\ft?o)zF]:qټtc\j[p^9 >臊}oM~I͓~8!ZTvmᖏD*zud AxpKޣ0~?);!R>z|oO]`b>Vu=*ɾg,tR-k鉼]J%)Ed&O)ax^}7F>L I~;*+>I98䎹hMǤi jM{TD>3 `Vb>;’o?)+φ#{τAwFTmۡt&v 25Jkڡ%F I0t((C)቞qnj^dCt峐P29µMTg>մ߻Asڹ`2b 7e~HԪ4.#d9N%yZH{z{%/Ua->Iomv\Atmlo0ni8י. mW k"1E°.֓9Ex *j_N>t{GɪO| T1rUK%fۯD߬Ԣp+]ҥ',# jȧ.P 7,]d/#Z #jј0t{ǟ=+~ vǕ19k5[/FlaBAAC-\bn/UxDہ[Z4kiG-p՗? XMSҕ asr7vUO'{y5UGkRZR2'?4xͩ &*}1ڇ(GyţKCqb؉gMsfяpC3*8)6bg#6t6Ⲛle؈ 3˝]2bAPnJQozCM|υPkeCpهN:{å{#.{ w 3*ΐV98yi'l{'_vlkōقaJP=5`伩7̯p7qd/qU'բkv/ Ӽ4W=btoeݳ3.;>.#Հλ=TFjDɈTnyfs>ˁy-T&+-:@]C{Q:n\ e-Nu.D{xrǏÊBIv&\uv=SɝO3NY.9Najhd: Z|$2aia~_ajUb7bW2^BN=*V`h(} Ǻ'up2!nUd(W#z=”cѓ~`Eca-U+qNfkWLH:;IE:<Ѐ+}KP\) /_aLUhJⅺW/Jdw nȡA?q`CT;v +7w/ <^ >|Fq0g~:8N\WKsi2yfdfGIGZ?mZ󈲋Ĕtg8! `F7BL# 1^Sժp`'x ULe5)c(k~.>>ګŝȋ>Tm$(u+++hRys|:𙇃a_ ہ| Rb'vΗXNNTcAΒ$YUho m:,ܘHu~_dihI $yJة̞5R?2nʰu@_Jw~gu$RRY)ʁ=tb\!,U ET|od*#vᒣ4c \֝9'st/X怃+`W刀v e902 Ѣ9UTTTä8yԑ!{هCTsvj{.8=m;ט#n%l.sdP\0wMcAWʀq?L@U_%ҳ- gtwgri(({jWdiEu{׬%ˣ1= #`S;&"o Zvv~GeZb "`VXEZj/0ZBJSQgt}*:_`Du*r?w&څ|dE~mJY߶Df!{znK|ʳuuZ.ض)O*~cbS z1O*vg VA{b*_2FDR[bc.f#2$xaM8UzQ{>m˫EdaRQ`+ ص_*d 'H"k_6wBS]Q%wEiTҼ!NjڐZ 7LOX FԢYj[h,u-e-wpVɁ܁JY T;XKÖ)w~֍Bظz |XgeïT}AMLL(E&^g6s?},vU>A,:\g^h 'YU=Hr5>j˙kGNGjXdw4ߎ%ŵxcT=|յ_cz5 zM7 9,+]jGnEի983J"^>S"uLFv9c:UWV-/2\lji<] U)1-u/>EAƥN?WGU?mگ'&ԃrRe'K׭jQ+f;'⃉m?"$rp/Gyh:w¿x_LpVbk@7uc^U~2CavUb{z᭛nn OLݰ=OىӚʉ˻)1ݿzZa{m~{nj#f/{1,HfZ`s̴ݶm`M1|y$ L 2mTY=Ʀܣ3-+S$[_h 3/Q.dsMŀ FÌ7P = :gwNxji=FZY؏qk{1ri7Xu%=emkpl7,F7>!-lC(M`FQ#Yk!q0c7"S8HNvu0"P˩{H{ul?u&<-U1½ވe#avz7\H#6z`Qj8Er(F#X_zLծIlá7:}+gLn Fs|;!1z)i^6""mEjv9ZCm |6:sˡT8 e`}ڤ}ӕevA][a.?z3\+ST=10L^{ZL6%2U4)u 7*;T;Cq 57i̗МLs5JN_=C'>DZ[ oFܲ;ѵv'GMA1zD~O\-Q˷th/)8̫L-1Vpff̈0 Kgd8PkaA"q orFק]ӡmj*ahz*gaj|n"IS2j6̅ߜ \-RASvB k UƦIٍk?$Tsh\H=ZU9O7Z -ZJK5b[D:^S&{jpgnK 9sYb|(jsjC{aPKŤihX @234/'Р$?IFVv90L[ ZET{ii*jP`qi">wtYO+Y"C"6Vb*?ŝ̥oX`nV}2 %v:nɈ*}M ,SD6sn`_ ;i4[aɕj9+g tx-4rDY }`Wq+YW?peNB=! -|77<x~Es_OӉEi9 : xa1WAk$1B3;gMS79̂z]ץy-&? j4f*G|yEl'o 0S֨OP]jT'X9RI:A D}p6]<(No3YL{zwKvѓ=݂N9V F8ϻEQWRRjfIS C(JS}P[OTe<,NoUtЉ@0Q@g95Ϧ2޻KLbq U*=|*a_~ _4d/5û,N1waKt>ègz>wCacd8\U^s: =[IE3cE<[C+q{M%NcJ;7Z87Lie6WF r:W?ЉVUNz.2 O}ZЯ0:j:ssmb6%;.:X+uat06oc_u^sա8ܔמ Ul+C [JUԻ/^uW , [v=WrR :f(RsC-r]J) xבs͆T:ԋe¨,`=hgU*x APԨgŲ0d2nSTAf=McW6GWL a*%Cm̽su` L};}$lW*JHWYCuv*=.Jm6T8mpq; c?"%p!4iFڕWXHNrkmZšw >25Ay&Cq0z'?1u+0}$s}`Y$h)G֧=dsc|4%>IVpbz4I^ qhqvzR@e=fdIE}zZ:)`VcԎnHgUe!x"~tk^3t:uX :AgN5cEjW}4F_dT)8MK{foxȈbTo' &ˏ;= "Z{]Pxoz`0/)m!sZdeoH7D^$%ܝ

rN)ϸZ 3A=R\~Onm9 |0t­dQT ι;bfa)ُR aLEse7֞/? naۖ^l?0kK7 !d7 cQ<3R٢K*BN5Y|Wz v멻,~`^†9 =PM`UHdcBUo bY<%teX^yzIHբy>V}F%vК<6..V` zg0ϊԪDIQָC-U\5*'OS[*ZJ Fm#@U׮țe zZ/ѫu-u ]QY!-P}&vXH/oőf&pZȜu3"Iڈ?7B7Ĥ\/f?Ԕ'D|<e"@+1-;a8q=ʫk6`*>9Q:r)\ݢTҎɦY < ZD`:Ѓmbo%^(DuEi'!|rQuTv]]5\Ck}2.tvHS'm+7\˅ɽ(aBjayv X M&lՄt"&'5sCRJ><;8=vANNpt帛Ry ,c<jzO4!4a9l}GpSdQo4\ =] Takc0)UF8`+Rj1\8av;p0_Zhx,q^Y[C.0y}]\~ɇ$8&E:X?~`Qȶ.>TrLG70d-'kzPhT,*<_̓r϶ĝqŲۋސ} odE'\!xSXziK%+G1lޅo JɊ^d3Y\/=R+09#-PIZ}]P׾Kgc3t*z|c_ukܛE08}H/esffZYܤg4B_P@语ffLunA5+V-,8 |EdIv5ɜ^ ZUY7jV[A5+bWsլH:>Rԯ(Gs P/Q pSa4ހP' ;: 06F/0 Aq0ߞpBBqc+LGJVW[g?֑o.F_bi@KPCIjӆꆥ1P@ vP{q+؋ؕY(8\vTQ@Vv'c=q6sK`޾UP\ f5yTPqQu9TP{'hQɡ" =*(i*qǒ[.bQAqU! %D:v&rLYP1lVնL77ǟSL*Pv33ޘ!C'ojS==pZ[ hzzQ逸1ו߿}=2-#M1 5z]ӘnsR0=6Y0:;7-;6Tk0uk4+b>>1,` 1[hQ>, {$[١HEOvx6S`)yHG/6z;p$nC1O&JZZ7@hSY7| ̵5/6ŋr/-^lŋqX@"sZN_= c)~NH /r?\ nXN_#/ff7-鋳.ǥs>olb>^Yp\:/ X?;q|q7 }.z|'{D&0ͱ]֧ TC| 5+1 /.+Vֲ0^N5w0Ͱ-/Gܹ,gvɺGЬث }|G'2D'Q}q-W+]8ӌ,[514`vpr8YZƬ}\!mF\.^8q+|iϺ~NRC/880he'i>'I l <Eb،e; ~`46h| MP1f4. XW"7=W ]f}+ZL.MD+S HL855^jgګ|Ɔ713ц|`| 0hǰ!E ܠY#)X(f'T!1\đOk}FKR)V4EҤ4)d dYSPOʫ؊ Q+|ϝ<CRy;4ݢr rTvzðԸ7UV^Ӯ gXb45T"OMUu"@.FFPBA=#mxKËd˲/;m3nlPBA:Ÿt"NAP(kE>AVU'dXH{rRzAk#2- 扴B*bOKR/gR1Z?{V(T$[*sD^ 2Dg#3|pXs8yoq`1s+p8 7/r9uwŲRE p{{H lo$sIooӎީopș/o {߬ҮǾwL7r!v | xoiH$HRN0N r1V/g#OQu@;|/1nk=?#l>=;5:+762\)vt*p7һt?,%q9_ԄwgRTڐ]"!DLaW IT3R2K}"89d6}˃O? g\w!\n5$jQ‡s9*~|:@DjjV{h+͝aJ%2ﭔVdzDnmDpꇄ3٘2YG% _, aV9j %30}*f]$e ?: J$wKw%Džyf]j|b#s2-=/r)p2K7 T -9dAT|n1h^HNJ{S0ؕ#6]aEA/Lv =. {1dQ>ơae}(La*bH~3^(7vlA7o^m,QY?"-,]T4CHO.@,Ú.#Z,;H]< DMDkZC-UGLgUcءM|$ص^ XUqԇ?D^+sqPd0 67l0cQ=d"KqH:$(.ШqRǁ."LUi%t4oYݩǩwtؿ h{pLhW*z(BG4*L{)Jr_W&R?WʝvʜSVQ+w&bھ3a3E;';sμ03yL|cW&;Qϕ9"}eb_-2Q4ƋWfŕ+=Jr*4J9z'c_sɇ\sQ@IubC^qaM9;⾜* t_nK<]/~&/vMS^ʷswD;Yjܗ"׏KP9s_42nʨ߅[R,=߂{d-tw sCɯ'u|]z l(7?1݇NAC'ŰbŰbjP/~\I] ~:sIsqe!~cw^^ +5_ŰγVpI xAڀ _*zPlzł* ,\o9,){u{D SF29{<I e:qEreeÐϯ߬s|S\.kL&@^f2Q\;(jK9XcXdb2Mb*/_.&S}3}80kcE36,d/&xD{;L&|3ؒ<:YDz]U1GiTfT<KZ`1GP,&p +im9.y6WmW$YL_PVn"*0S==IװhW >6 ->AG?=K8fj]/8Xy GlOwKߢÏ2TVjܣ (HEF\ Za5?pROɸ; ~EjZ[ozKs#/nIg,K{K}FY) Dp0dub! zp#EǬ?曹膂}ӛl玃37]VMx3]J.=Qk}TjyyÕE=B eZ1E@eiJf]@n6ՠ0YO*.HQ![Ss1`.Y" J#a5qy ]p#trq $/* p M݂ T1U} @=d.2ɑlnCG5͹BT:jB;l$c^?ՍTxm$9[ElԘjSmUKA[4 #%uo7K\/ĭepeZbCaq(>+'EBedN3F 3{&TsqVs&}~@Ins>!3sX̘!X>9suƸZգF명֢8TL:I:59FVŪ]o5ѪnS`s Ya[坊Ao] ].ɰ%^JX;M2ǥ[4|+9"2]"{mwn|v/v>}`ǵCk^h= k.Jv{mw;#u>)gͼxsv_SnlsliQ&) qBk5 GN}Iv_QRг@FU{ogiv_q5%c\z6w߅Q1߻] 8*">t:9_ d#^d6D24x|jT/Ȟu N&PK.Rl"(I2Wt ~(ҒթM)[U49pa $: I'd;F; ODAa= cf._U"8(_%&F;KI1K)Ȫ 5A,mTy#|aTm>.lD_[Kw=F˦RFM% P;\:עҴ 47i\=@܁R\Z*M>_>"k Ţ9Jmh,Lu7K=4;(*=EB 3qa: R^ B54)v;dQm浢Rſ{5a,7Zb&-s=g$Rj\Zm)ܪZ_ Uxfj6%:ڶ ^5c$]U,.]hI?Um$ Qr/P9yVNn3hGO(uWTCu)$` 2Wqͪ m&j3&Tު Cd*\md^[5Yj33l-vJ){ߖM&1X5Y;#SjuvQ5:;VD;|X5EI̭w+uI&.$莣j(nq6^-M7TM2yLnvfk-L^5Ik͖L (pC3-ץ]|S3 {R3=}]I2GJd _k&f¨L _[/RZbDeϑǝբZA&Jh4ߺK~4˾a:֐DZJ +. :dfU\Yd`IMěQ4RO(-/uFƢ.ݿt0'IcYakSFiw8/^_FĴ4Nؒ;R8R"zQCִ1.~~_̤+:1qTV@x_#+ [? pa) |/*fl4H,R~TOnP CU{^ >iL[|zxCej9"F4HWƜP/i-16M - S|!}~D?*;[Ke ~-_s/TJ|%31lcdoyY]὜/ݽӦ~{T~`Ku{ƴ'ͰV^3xt񲎂<DWp`;KnDO+(7g[(7vv‹DeɒF% pOAPhV!Bh<)6L!p؈mӱWG95{M]W'VkW\Vsn>zQm:)o/4ۑ3ee|Z5HbY^چ6tomome/y1r;f~7Ɔ_l+T>^_%)[81"M_Ы] ʯ:2./& y~/؆ߍ8/6׵b5,Pf̈́j˗+/6eƻ̮fQ _l0m7/ܖ̣#!i񴀴x12$ ctY]|ODlީ,2{sbfUB}iQgfs[q:W:c-[5\jK:f>6π;Urπ @լ: @5|c1-u|5p7iu`>u`u\VnjyhďL1{uslzsO9_Feߘdbu~(ʿ,Lp/'<15 [̋C*9kTY8 cbGaUw~{o&bUFWxկ\ѫc ozszZhݷ~~e{_ƜQ b<扟?LW|c',TvǺZ̽0C(qC!C"R;η (k0퉡 f e3GG"z*~P, D]b(@0?5uItrB ŸEEG*Z1@ruru9 m$Gkj7;O`Bw +`D7h%63>t"+o/|%>nw.IZMpDQTx+s,0qwL\ 1r1ZڍG;b+hEox&_ȯY1WfE10'(g>j=E/Y+$+$*QEUENbZ:~DKb.r |]uqPmmXiQEUf b=XiU%' ;I $aSbYn#)OVa T+cܞc"mD`En 7 {.IoOOnjcF8C|^z=уCau==/wҔ|gܳ; =r^N{΂ I.ƕr]9آ)s󺧁)q̬X|A4!;2kN\_+ni>N: >K9!Nh _ġeyqk6υoI'|G犆t974T742;_9މW4n( ohNg=7t3'jjWై[7=Q|Aۡށrnu+^qCD dxpih;y99ۙ~ҷgJꃃ VTyne@O.0xGYg&G~AlS.'["ɬx½J@E9~=bEAN'e;lgKY@Wd W߭+^I]AM+ؘ3{EA5yvuCҽH, 9YA8aBoccu*sm1 m5=`3+De+6F,W*kCHn=m,}ɱ*cmQto_޻"p0p`6*ϣ8Lf>kZ^, 3q㛐q^x!_V # P5ʝT ۭv$*>(T-X;$kU}X.rرv@c/^o,4\P3-“ 7 n*^ƪiZ}3x:]<烀ѽ { ~Ǵ<д$\5S),7CԒzhJ-UJN/{$&]ܪ_6Oj7ܿ}cyaWy!d}=o/Wh ?_EK'@X45W/хCb= *t$g49 FVd[Hg*kWIQOV%+[ ]y6OO wЌ  8֒t/;'K _sҕp/ Xnje@>dLiNpc!%fB<,;YLKX͉RQG Xpu%$kG6q3R[*{+_-PeT+;>HNk +Y)}!k?`S%`ux(̍ü<~I puJ]"kBK1K&L#LBcig{0:\r9ٟxХs爅 8IoM7N#m;渇C |9 9%>Ec]O>cv9LjA8fu̾''?'y U|1g;b9^/ο/&Y *: 'Eayz ]u+~ bz\^dQo) #aw:4 1k 1rr^:&W[ǕCnaH9o"\oX.s{#`R)<üqcz/S kS3Zp3i>(-V 1oq?a*HI\g?@U/TY{Ԡ/j*xAUBdIUrD |}\ uVGL p_̘J~ N%:)1*]}8 - l#Tu-ja>Ї"~ V>]#L£\bu0>̬ԢwS"cᰩʚ7LaQ &ප*jb-<1Zi7\NO7,Ϣ*]!?3w1NI!yh4aM5prT,D.H՞ZIWkQ1ΪOGh62ss[cQ$`&!O*Qxk}UɜϢBSg5},t>Ѥ fIu 0MO'%fLaΏzB-z G {Xftp۰ДE"in8 >p֮tMZ3")=fؿJt8ǸD0{g tyah旼o be zKro\ %p q`PiB1q؍rtq̦  E=!LHoMb}û׷\WqTZYd!3(ü[ހ2vaz~V}X2Z^x}(㚳oš/x.dX*QVb~W= ߘ WdIe@Gݠꂦv?31z"5U]1) + >"?l7.AAa-X|UKGjۃED=.n;.i]b94X`GT7* KO;%&*>"I^]s~j|blYT!7yu546dMEV.?vfP 6PU_]o\( a*% CK밨gL u8?lM.Eg{jˌA NjhjB QYFʟ~G .r^;$:KnsB"siu1g~**@c}]W2Ї| %A>ByC'DFPj<ܔum̾9\XyW]}'5Wp]^\cX&QV&d98LjSSzPhEf]t &á1jv+ZFW݉0ɀ07!Tы f21EyNW/%(p耕kZ1b>Drjf׀مyjqQ6 -a)K2VD`vxMx''jѸ%CW.S0=TmS!|{r3DstK4{6L:w$0YćFix7Rq= en*O]}{VUr.pLްfdUfL'k~0<KϤT+ךr@uJ,۩r{]˜2IGAz͒&yK` 7SQ)Qԟ^g `᳎~jДYBs@uq(āoXS4#nOTFߡNcXѬVnwX$DnQ뉑 UCqP(}'̇5n+ v,b0/4ژ?/ "^O _ܹbABm]4XbE_9%WYEܧ5j-1Kڝ&fo|69ǡ/ssW: ,_h#آ(ۺfkbaﴨ讎BW֒):}KA]eEpɪ \y[ ;a۔OhNsҍ]\bUBhk`:R֫AVkG]xb"ݵLʾFz9_GNXu/ ssx?<#99:uZ>IŔq^9\9t\yFnc%{a2.LrmA pn4c] 8+X}` `r ``3Y/Iуr\Mz=[Qَ ftYSv\[>\T5EC Fm^EŅ#L8*Q}Fp5mE 0 @z \YEC k /遥1nCQ,9!5ߋ̣{SkF0'@_܎\ Vf[!Lе+#;SCw 8E\Jv"^*^ 杢,k;e]p#a}W ]ł1;E|/sND0U.+zjfVjQd瞰ZXHSOŖ4ef7X٣}:`1# F 8<k _F^u/ndH=r4FمeMT0A;,]pY _N,qE{.Tze<ݬ &t@0%/Dе|m$0OD: rZٟXQчӻ&t[9ت ՟tåT"{8ǼZLiq|ÔtLIJ41#XO:/a3٘Xzgy=~_%fy z3{LR:zffբ*[p{-j`1=,]OύټS Cn5)P0H+؍bքA+O ztf6ZH|z)| L*]wnqn"Vn-4?p ~kc i]7eKF<-̘EC\Vex Lj%on,o)X$;SLum0,oׇq_[3>Lpc𶼍nKfKڼ L\ 6ɑ5fyt[ގ$~!ooxcyom|#9]LcZ:KKq,]Gβ7[@n~hVיkmy_b5e۬#۬6m ucS?Y۬m6C&6cfm?fw_m3`]AUq-ݧks8]1Eyf}~0e3hͮ>]yi+Ct=}~F>.p _PO-+|T5}nW!߈ŁLq\rF.ghQjni+;/.f/4k 2a K6TY.z#FSrfscU8w/<\|X T;j<6ַ㥧U^n+=zkP%Bb=-y),uWD^d>R1ң.}}bU) fԶnͣmDfoΚNCT67:R÷UuF=_mL≮oD2Eۼ2fZ9;kCČpk)y%@}U3}MТb.\[{aki0Kۡv;^YLB$a-(z%d-O+]~ngk7w&{iʼn06NLATeWVNZ|ɠd$Mi)MvbS><1ݎ?a<[T<~1COJ+x dDGW̊[9\&F.x96ƻoŔ:}Ӣv]^qFme̦)U/iY -Gh2"vvc2 [@dCyRY 1؁@Kʘ=eCWBu]-S:@I[-B"Zdhocc1?aO]b'0n(zkhe!Df۞2OYZ#8v{mg ./ j# BA/0-+ ^4֧}4xaD2* Ab=cv9 ˥LA# . W=kZ?ْ8CrejÙ=n_`SRza֣Z>7)zQ; !Ƅ^f7/ϐH+ZGX9†O 7tlPb*wƱv]|lcavE;(\pLp <#ȶ(пw4mc(%5w`wsڡd{]J3[f6ƲKC.Q ̓e;D7|sM,-OF!՛ପ݆d1M1%;~%١adN#q/K:ǹ֫E%فQ۴dm64CUuۏd1[%jYĒajm+d7ZhLOљ,!xsr܆dձ7%d do$;bD~ҙ 꼽W RY`d&yM6fq(I@J;)7\Tt>+\$g X^>_w(ߧڋA!w(U'ef>`/B[ژBdb xFȌTch/`_V9}HGaDapʯo^̰T8Da6\}+#ETP {9"X>`x_JjPNF%9Y޳TCp8DD ^|'`'g'hsr@QD3E I" C$$eP6(I'DvJ\K$ Xe~Nny:Cq57Q³hQTw& ؖQyz:qڮI9"9"F9"Ob FurvK^]XWf SXVLN0SmCNE:^ @1^8aS1#Wv`俘=@ķ31[߾ϋ E[_0#0be9cTB֙kSyv:YUD^hwf3p4kݐpO/X)n r"NITպeDFr"GD)k&r"MWN`*]|cχU#]9a JD@s 92ܘΡSt'گȧ0[|fYR|R"p>t3%/qzɇAyfUMf\VEkΫiDɼDȯ7.DOe8!_Rb(?A,^r\${ V/ŻS!unz ũ D ~`J3ӟ nnGCZ<%$p oܛDW#k:#l50x*Ӻ>}$u>S1q6~;<j0wL缮⇏VRs芹~B̝w#siKcvPtn RW/NN*~{~WD.Q'y:ؘ #01xC"qHbF/دtEKN??[yse %!FkӾ=~ 6f2߰Q7A! w:qb~b+k%T2T7ٸ0EU^i YT'NZƁj^k +*W)umf"3XubwĩҊ\־@(UMI,EqN^ZL&Mhzo?nzḦc `z0LrVfN|^lហ5y$>+&(Xe 3jCݢiE ]„F`ѫ4wV*URʼn .npQ!ܭ\F1 Fl*g piOzs mmQ8X<8\-WG/xeo+TeQF`FfvK?;pGzGBD~(qD$fDQ<-~ -_ %J쎂#Xv&[YᲿDwFA7s;LO;} 1ŷF䎩rBJL>=,A;+}XQt/;~X;&b+ɽ2fHO,%0-f(~%sWϏO֋5i-_J|^"w(玦MNzx.$KH|@c}YZ|'C,њ){)1a_\)wL|:T"-wQ}JCf>տZ$|a|_O}liDF1穓 _L|<#V/0/_bVOߵi@-SB-"=ꆷX1,XK{ |q9jǝQ$^0l><'(qw'71~ I{t'œ=j]axGRbXM#HxSRs:E$1g40D=9̬Rz,k @ya( vmxo،cD>,"{nCChK j:QsPc:6Ǎ:q+~*GX؝d򼇁ᓝ-Y#<u:@(e{:. 7|OxG<|IseѡƪZۜX=u:+wc&Z~A00lR`q tl#g~j "=~󁹂VR^*>2Qz$<ѼWg[zòO 3o67B#`eji{'z9XMu!ld_?N5u욺:+`ά|C 8;| !ck$ :1[Qhn {"G+Uyu쏨4>uT8B dnAt.O- 'ZOKZF^- GW6HTbxŽ)5cU:ڪwbNȊ玍*0r 0 LnIPH`Z q@2F.Qrͱ5odHb"Lc5-Hv$Ӵ|Nl$G2Ol$JPl$q78%*dQh$zsC{ا^Wr䧌.Y5Ɓ>+]ODD$Z.ݡj;0  29}#x7KOk.Ch(mC8w;{te8|zz"z(NQ),~ÁĶ%\j 桖`. 4B_RXl_OG!#-ˆ6kHa@A\w ockQ*>_;YcA*>N=8eqΩ%ڥT|=u|=3-xD)+J>|u\9X|=9'|N`_[; 1_.< R*0}VsP1)_V]OThPOGjU%Mk?B-O"_b7m& PfS4㵆`l_18 =ML= "Jb`&w E-'#>XnL+P}s2@Q}u?-n? ;q(M{.b~:/̾~\^Kpt/yn) JL(k3#97fxyōxDۗ7 TdlFeTOx!}B+8 @%(vN3J 8LM-BN8Y-岮}(SG~Ř6EX&G`OnQltFӥB\kpR>iT;,4L7>prhe|\ʡ|ul"H'$rDv_&د(9sT!zJQy(-XB9rkfg=^@IAv KEzLxA2pd" ֎ . n.""úi̅56T !JJ*6Cs|0B33Z/55e|v:u^cǪck _[+*=>Q+wB9OUٱP/4"P-0_ # ډۮ,wynx6&;z]T~X**LF>|:;eɀ06o0!7Ae={@˿|\W qi32# W@Q3jJ95pmȚimȚVTgst Y!m904dMG؎OTgێ5OTXY@m""!.7U}22CGGfi姊[_X.W,*_8&-*/ڣv,l/?UCOu=;v l\bEX'|E;:i qudM.7 YETI}gpcX(CSj~8 8DY\Q1P!R'Zg nEU'+V5/"~};gdYDx)A.կү8ɖٮeWSrQ>C^aD7ϘH.-*1`#OĠqw-B7#E"j5vMLlWIOv?"mk8Vwr 8%X:$m q9$1T<`Oa߷KLÆ|iSZL$'Ul/$ \γgkgcrZF̲V7q^15*zƵ([t/FPv9*ellnG lf?r{ δ:K q<1n1o} UoEfƵ_RgySl4Qܮ7F~;& ۥ#<9w0wL(Gm2^zer8P|'VR~>V-W܆DN?ڃC$5 zXWmCO |.ƒ<W `t2~Ą@~ 8d@8%ƑF28i@H\bMSp>V  \_\̋s0ʋ;(Ǽ8jcqDyF@ëT0`KIqȊOLZ/8 8޸ >Zfs6՘5(..x@I~,{੄qJ6LvYn-b82פ(fO\nƆ$0U`{]= q"r@"a-}`GoșwerFl\#bFg l Rf+!dEVE9<)BI^vV<,gB8'#k$X }ϯoB%.\'~'"m}c~(UK8'B@7$DO%ՉCiu=9? ݻ1`s$54i Ϥa۫5PrGlδiն5Xlص{;zQ.-`xt 3躚#" .> g|D/,x g{ϸعRqgj~¥ ezVl@tdO1DŽ 9ƜxJDZoOL< s|=Ǻ~-i^<[/1>Cc j яǠpжxcnHx`ȷ0`4 E$KLb0.G8ѼSߥ=8Vًn7`Q%#Wթ'eآ,)6`"3r\/X4]3-W< bg1$[9Z^-#8U UByL$4ĬK [fGƦ}SK^`u"5a!OoJW4xy՘Z3Nn7{ԒaM !מ8ҠIf.keN]dIg"bV}XyTfi wtWk ֶf 8NJ2O;4ڻ[ϖMD}h⪟Z+ "CL4Gsg?鵒`-($:K0,fZݠ2?uؑAog`r(: zJёI}%<(rfPHwٗ'rCAW$4=Xm -又L煀>#GU2ƥ:w0!,ȅ 50k@6 (dKtSq0.P˧[r0Q  `f9 ex? KLG`)T˻@e:(袐 EpR3-,(iF(X FO+XB vg  (Xv,Sj-v,w,AƖNб };#h'Z^Is0gySbB*"#f?̿3_k\OUD)AE Z2O|' q stO&O:=#6+ +BAF&_~ˋ :>CB|WrHg˘'GUߝS?f?-7 '58l =L⬕x:+iJaxc#luW$VtenV-K#B[^o7AD/O/,eۍ~8:~bIM)};AK?vrF 9PöxS8V'SAm%~\;隆vpPlLv}t:XzY fQw ˸0-_?@4Kߑd9SQ "T|2w}J9SGE]6Bq*ʹtHykq͒k6вU2 s%^ m(Ig2Z[-M?o>!VK/=Pt-fֹEW5^`P!pQMBɅ|vh}B`zU䉰Yp֐(3 B8I_l/()҉py0z"0H7xI@-̹N.J5 xa!&` wiԏ9*R'(xHy+*eDh4MoNylżˬ ۢYe+Ӣ3a\y} ]5{Fj\t&\oGC8]SOwҖD7c$i׮ET{5ɛ'\MnTVl0L9v MO;p]( gWL Z7㸸ƉJ2nȦd<|KǢ xb7L08#"xh߾qq>~|ž1 ַYO^-q@CJuZ|OFLZ/lzOGD1^o ynn wV~TU#ʏ*G@k\]ӕ/rRa֮*~aneweЕR~0QVSؘ-T!ny0+?lGSKX='ݪHK<_be]̈ [vׁ˃_ʏlꆍc?/f:79Oev sO3~v>BUz܍bw{5{գw0Xm/5 Kuo2 ɊAvb(&t{o!`4OXe=ǩ {#'u.{^e ĘV'yٓ\yY^{t{:nEke,LG(5̢t،aՄ~(ӓx!|Z<^X~t fLa3eڬ(ӸZ<ʶ Zgs_ Ts_ |a(= SzG-J⣓5.'N.ŗ'$"_c_a4jq,R~ 3`Y3}5QT5?_6hov^e;_WD-{&.(/L1:>Vn̾Sb*U4 U$ċtb $hHP3iini W|"*H;!+fg!Ad0+nQYñ|/] |&?%vVYWOB 3![S}rg׸s0{>iYSmoL3#Z._UyL)z0fֺAi˶֣JKZ=&"%]h$gB3 ?aθՔP5%M>\:53H\#_#Sk8?dݾ#<8>+̺rqȝ=YKeYogul)K}ZDϹLo}ÍҒw\Zwh}c+x:==p"tsգ_ 3!z'H7W {(8W= LڱZGW=gמ5s_UگPJs 7=u碇ª%^E_[/G,TQ)7s'"!A.3m{ឿ᳻'"^\)Y#?̀K}41f󴘾5XBO0̨0VsϭrʹL~R i^ ͝1"lE lUEoЍ f<52LMT2CAM%RPlE9ÍS,b| 2 w1 xBfDsӘ.?/GvԿ$LyEMfdt4?4OX}Apd9MDsE2ʱj+}@}k#rf&/'"~2!\^?n|9"> @[em9 3j*PXȬZ߉:^8*sol6m96UgA &+EZB-  l={Sӭ֒ͪ!JlVp ?W=0T;۬dW9 >4`}~ ޺Deht?[#euO9 Vp:V+ YꌆVp PrgΝߎժ":KШX‰LΕ"x6*4sVjW#7sXrdMρĚ+)H#˜^Cj^7 R%Xt4#8xCt?q{=˨ch}_rj{+,@p4W^j`ɻ *pKJ=% fZ bnK.+FBQ̤cG#~6sȬ78w7{Qt?ѺΫwF<5|(a ȵI~{Ѐd9cqdX7V%%/>|U@ZZr찢HfbPgIsQ,߽ 2F"8d <~G̅5;Bہy[טoL;cR9]K7*?8Bz| ĤKYv&t (!xt:?J<+<1.?Z8md]D T;ԩ>a,Tr&/?Is/;jQBA\/zSp҅;0߾.O,dِ99i^ݥh3#DϾRK=!5ڽdמI{ y09@Jjwñ qX 6TJ׽!\ ?TM3`?C{JG,З9gfcaS_0 J I4ϡCsB=`0u敃V`?H6Gd*ja*8B{_%d+|o_—)qE8cs}= @G\ 3?M{ Ɩlw=Qrq#УQR1䝱_>ɵ>pd|G*| Ts>pdMYgNwZQ`ǵ8?B ,Vޖp2i v2*> XZkͨ:x(ѩ/ 7|b/4ee0#U*e{*]ʼ7#Kfv-;x z:|ɿw"6 L] ]ܼLw)+FlWI[6!B׷:nXm gަmʷ9XqR4B^i-–ԙr>)|8 o \0sWԌ(3͗)sk\ dKJ}6C] ^"8 ߜ uL X^;@qک1=tc>M+IAGqZSn"ۨSv1E[,'n i={81h9NA̳ySnl%VFNNGh3-wr>I~NE;cS(\} \yS\:).9 SbMҵrS- )WuHyS>Ki Dc!S-v~о?<=0zx>"ړOܖkJϲXB)i=Y:I7 tYxG#ҙ+{a/Mb${3SI!dSe8!l[Vm> LG:t6Bߝg4.rB Oj:3b= DoO*鷒3@F#DH!}tP@ 4*ag# hT2e@3jG1.Žu""qD4:\ ݱ82p"2 Ɏs!Yl"RS^{P+(uE@!DЅ@6xJt"¢uw}p^NqCT'E׫jM T|. ־PIޕf\2> l2~=Tdr h!W肞`*q:](PGݗ#ʐ~He]y< -Gp9C8}`z8G;S u"Μn'ĈnDV.4` }>7vǃ4jyj)~'No̜cHY~s,vZ~px۾":SJ~#>'69icZLj|Spvb:69/!soF ՇĤ?-1yf l!iϞAS7=f^ S+h {hć\$:fMmW~m,Vc/f f́Wx }O&N+ZJtKcs{3ޠ̀^B;s1H.[}lf@48 @X厊t NIP{9w-SIn^)jESA/a.N.e}(Oz"t(qI7εx˸Rꉁ]!M'zԳsNu,1&0, U/'-@ؚ ǫ_ic ߪ |2TɀN5/^/~*DOF?OOcy=fi4:UI݁-^EѴ7ȐoĦL ii7BxHqb s1 gI˨г:p yblz:l}# ]mB^,9uq YHL̏/mT.]jE;n"jUV=̨~@ &4鰛k8\%~Nq'fr[:ODo*ͤ`3ך?\Z|:Ý"JpYnؖk9%N_z*8 h YPb| Impq;H^ZØ3u4޳9NmP;Y8Mgĸ_E۲݄iiн<4 oi8FhԺe\s Ǜ>—-]$_R k9dA؏*L ˘&gZOY&SP)SIO%f@0Į>IM!z̮fm̏tIoxS(NÉ4%LWSήTUBFk="-D/? d:yq=ʞ%/R'fdNrqX;k>趛|Giun\MvU&F, z`nɵf+~ zt["d*8ݜʮ\i3f ٽ FgbJS|ՎR|4VOUї }UN,HfAxMW!-1݄Yz:PsNjZ8fذvv߻~S@=Yv+6͙D)R~v&;VB*CmJE庰X)>z:Z-ҹamtWHGXìZF5(WofJz% 쳪ďM7h9]Y~@WT 1ydS,b6yRh QIJ-oMWF cAtCJMۊNA#ޠ9$5Zl ̣eV7-4@ ,;im4k0)^ڥgZ<؈-6* NV,+&eV/|1c&^Sygm(G-0zaeW6Krd ԹO'|^Sl D̾T┴{jR(nmkeq=E󬛚"%\gIW+?pnQ*2n੡J?p?]&10g0CBSy,/o=O ,M=x`Xx H"-UGW; fa]h YCXAo+ o 8˴D78$YzAͧd.P~s.u Fi}|>zg" Eן8wSrjWUo^8/oA3kzZ/|Ip7B׵sd0QR D-UV[m3* YTG`FчM?q9PXCa(Lm's=b/grNmN 7 Cߨ[.DN].PpwC?^x47}"8?e| k̸g{,D< G4i ҷ"nyJ8v1ĬFer Ģ1)'fDz޷|"u摜}}>N5aqfO <.|F%ґULӈsdqz%?V:Uv*1T|zϜ;;dxpsqzJ|ʨ6Tӝ 赳~4uBQR>V֯@i^Y~uo!Gu᫖\shr}.a4℩\(o|AwӺ]5ߚ!<;1~wù#3m7?pSNT29w۩]k ƫULW>د:qS7/5a.?֡ [-AoAnJWIT1tj O!|Ͼ˷ǜĉ[{dw@$&`ZSw88ėX'/y,zpg^SC;ӿO罟JI3RJxP pJB?PM:sM3WpGI-#[2LPYÞ=j9.!i]҅Q)z@@zգN D$,kgCR7b_%*S E=իSqyVyn1Fs8[w]Qa kKܛ>w.i4Jc܁j+tl$Qp0h1I@{;Djj~zO[\1^bْ[jK/r#w3|JF}ѨnfЅ4^G5TstTZD.E.؋K&ꌩ;"k(X,5|9KQCDz@YD[R RKپN$Ѿ9߉:3NtJXNdԢA+qC,l A7KtťHD>Ar)\ w4 mG-D* t%,NdrP`c[Cp#D3J7"W%$ōȡ>߈}_>5(q۬:?qmH>bjudt 2!7!g/gO}x~>tzE { }v]yy_93s2 x_4]Ci~sXclcޓx,]azqFL==%ۙ6#&xT_ctdAs*/XtTRIO CMrS7qSZn1 .rtyPD7*\GW[Er䖍>Vy,#nJ.:&yUS9$ S9"n}c9#TG}c9w=^>#IWhyV1 }o)O 5zSW4Ω|o8wp{yl߀zvhEp_뺡yeןV(|W+pQA:[LLtЪC̠;AMm{ _8F:p~;3a[ Fv3M+&m9L: T/Y̘éi浽 ,Єk &PX2 hb[a=V+%WpoDH7ThzJ}0i`fWm}p S>Ÿ>/qinvbR\~q!Vn?K[>\hD 8G[i֕eo`D+vqA(wb3*y !kgLT%x)eti`&La\K)+z' ;GDN%ޱU ?D#\J}WC^"mؚ,[/Z9Lw,tz/(6+;5$l^KxǺs9MԿ-]#<Ս|=UzmjyVD ԏj0G܏9:r5N#|Z|VGEVO莏*-iuDO_mΠ9ڧCX i**yZM%zˍ4rCG긦(WHjpquL^Mys"@;A 1-펢<"dК2\j]JpNv5efG6 gٓ"*>te٨dU Ex;n&<^]^t=謤*+KJw ʇ>mq sel_r鶨S!<-|A`qձXTIjrF2Jk{X`nib=C)[zx=N/'٫:Oĉ(Q2gFxLLO 7b@)iÄ{-XӞturr)J;aR& ZDcd¥#NrWSD(Cn<D%RӬ_ N!uh|fX9J@BRD8D@IFX1s[ hO){EEF#%8\D O4tP+~X#܀(n%- Nӏb_x:\J{-٥6wXJH+>%ݘS.EJ@ ݇0^t)`]u."]"ѲR[rm,Ӭ}$n4Y15ES.lKdܕhׁT"2;fRC.#v6JakGͶZ|q SgvίM5|J56B{\2 {:D=)`"(mJ!Tz9r*ẃ7dtD"skgnǽ-Y^)mS){.\%<3MNySi%^Ѳ%^tu9^JkV/f=\ ZND-̆+S#a"eG2z(D~ /WǍwxVQ[,)z4_$эԎɰ IWW1 {ؽXdvzuґ9FjYiւ0Ӗ{:/#P$-Vu~ tӦG&2L' hLh<\v|eh%_';j%^Ds"xCNq\Qɠ$3f'~AIHtu` utP^VDb7/UˏĠ?&rq +- ~7SrM,|ܧ /ι_D;sˌ(8qGWr"e ^,ywp*gKgɸр LyJ7Lܢ# Ul[JPv->Vd9 [2'Yцp aoxI$2K'U,6'Suf ]@耩n$s|ڄ/;@J@9 z9YK!\^CZB z'ڇ4>QW^i~r'8tm C_Sxܙ)3W0hN'|# 7yE0lx;=߰9@'ؑeNuܚcu^Žd7D7 9Le5rNH @`cνB#C#EBצzh<xQF0E!FDX'5BM[؏XxY ϔ1tKQUjRԴ(O \} l%}0ūW m"s4Օؘ1Hq_iRȱj4+JB*$-R^8#EWEMG4x?4XDSXCFt"YX 7Az2 +Z R{|IMB2̢F7jAQ3*?rQMɠ;tJ3I xų748'U S 0׋Pg^w53d?Q vEq~ٲ ߙH%$ìχ[ wΨxNJJǛrl7ʤ$D)1iN11א.5tKgM*g;߰Ƈon|CYQY|@+fL2` 9GTܽ/u>oH9܀io{3-H:kyšF3 dk>o{)O_}3޷V{gKn˞y[jtCd^0,z?b௞7?wS~180?rk:7i\<};cb3ur4OL~@ZqQŃ)ou\\;/Pa}KuI"8m+Fŧ9v3~ݮ~G}0ђQ>~J)OєzBxT8#YKdfKH:VX2)yQj'W?wMkִ4Mko1>*jg$=b+NZ[SGrz u)m>P,|Lbj; _I.bx0 4Uޢ5^} CrnKj|hE~c~'>`}%7CATB"㾁3UժP}⮼\/C.B 7-YNZ~pVw1+c;a@3' 췧q^7^,JR` w+ &k1Q-י1a>?JQӗic$xpzp`S& ^kkZsěS9nE0,?3oӊvuHr49gteMӫ+q󙀃wwA |**0/q0}x1̝!ߔ431Bt+Jt t9"t!ƧOܮT%nW1Ia|}?^%ig&^aH;I2C QW1c,{_ me|!Y;l+Hl+ՎV_kGA>R-"M ~[ BU_05?q4m@MiWH\b b~h S )N+3m=5Է+9SD>Lj%}T`?>axȗZl|cBn2`1{t\Ed ,M6tՆBm_SQ!Эk {9\2U(^L{Z\0p`|F.=qү W +[U:+$Vr1jDjwWFI(=Eh!..w/9j=8(}P'@' ƋuY:_3ЀcD@֭/,5 :^ USk-="|[ NTza^]mKcx-~\s_{}|E2!宓m¸+(vYV:+:lV}^P&y䖰-_y[]p󒤟1xKP\*Ն#J)=j#`ɱ CWN[j5^:O}FiYqͿ5^ +5S"R;v:v{>sIX{8ae5 _6h9N ñhIVˣ#d!,w=d,6wJfjY~JCɜ8|C߸)(Q5e"|v7h„\p%3{_ɜXx ΑhUΨ>wuq-hLGP4kj{<0b[:BʕVkG6W$+kQ旐͇>9q(JB6=nF8wmwZxZrb#{Ϳ13&Ξ)G939.= gp” X&!ҡy)wlƒߎ`kd'An~Un{*є7xV94,5EgJ0wZ g8WIGkn'h[>D `SQ"N3KaGTb3h| V=z.3'Sg_p5M`mrߜ=SoaF S@S*R)v2*~;RPd tc>8@m˷KS ה$o\|Z^ Z7d}N }CaOЬm?d^Wz\\E$QKG3 7DG7nWcVgF-?O 8!Y0ДjuLxZ yYP\yYhO ш#czB UJ:h[1(]h`5bVv9|Rs8gx]N3ahV88! ]`. #<Wp5/{c1CV BO 1G+>A;3cuЇ=']AHG)zoxG,aC*alwOX4:5;#Siv%?s)kKL%x~ldt wΠ&A^OLbnɃtbTS'~ʋcN}DK2K/(FW,Z8M%kj^:%\! _DWKLܘ ۷w-Z%Fӎh=? {Pdh.Sř ]_?Vaa>'Cw:?qxU>5\#==|>^^u< V[4q(}>&%={ ۮdGA"4|h$FoQZ>,賥D}_Ff"z[?R?Ic=0⻠Mq8c(B  н:Wp8T /71g"I +ͣ-{2[Qp`{# c%OPO3"O }S<]}QpOGV;ܖ ~'W c|Bpf9ZP}`0"hw׉Ka/$GШؾKGl_l—>~ci݇Z0/uу@6 ~a'FNUfG2\]Qy9BKxGH-ess:'\8p+p8Ej0a+JvZ^:DHme];Bj+J1A_9?h{}XzqRu}:~FL/'}˿qd X>9I}}^^!lj 61!Q3/> qշlpә'g\8ddž<>n$6&d}ti3 =}__(M]'J,_i>{l: M}e:OHP.ZPș+@b. L]SsӮcBN˼4ƬC) gMxI)qp6)x}В5(Wi!DYzkB;ObۘFp|:ˎOi'$@Gι%+^WW~~\W"27,ݿ n8ו }>+JFD28׼^W+1Us}\W)13]F"d_Z+={~!e.bG't&=`[+TM_#OFxCHDׯUSj9wy'@7&:co-E|پSw.}쨦Ěi'n3jʀɞJ 1iºw^}:nfLpWhao;|~TCn TWsѲnp~JTiy.yMW9.M8杸M)`s'֓NzU'^Uzl5~ORɉ'ԓ'G&ꡚbh5͔8G`%x<2v7ܙܻa } s9pDBF qI±w;Gҿy;dA.) {s{FAtvxާgZW>gl痣\8!hՔysbI[a~\In쫴rlws F1\y7Onpht4u8]@3ZSG@&H[fD⽹<[\34y{p݂. ~i4`T8ף́n2~JtFEm2RR;.evPbhsR'*t +ǸNYh"BnGĞ4SH TrZ1cm͍Q5h:ٿ$U5~0pzuG5=ck0#-Njt36X\(93ԋ&0儋Q{Y/'/7|5ҲUMC@d[Aպ<2wkht﷌<ϋ#D2_ufb]Y8E/s yo(TsV!-xzJ<{7{oD_Uϱnw/pm*"Tu8}JzI~DnT@XteI+=q@V@+ldP:E"ey6^⁥m ̶LوmHUxb()1tp(yPHK/AJg LniNo?qHH e#; N pz_!@rԇX^4:KP%DMC4zTR =ZA?Q? $۟ 4b:#Sy5#:S@9̙o"~MQEɾ;n jV}H99pn5_9о @vA U{9laqo禄$GE'»KP(G!{'.tXJLP|Ci޸.7섳a$7n hلiGA|My+apCb5o"vgωY#$% \ݞe/|bK;|&3לDE>nY| UP)swZ/'̳s_EG)j9emftF q { 2 #4"866"lF'mmp96]˹ñ5{;t7m-bY;lH-;k^su)J*c<J]BiYh'kBR;hY`Og3jSgpҦHszD4sw˹ZjE ICIˁ\@iI9؏p-̈h9$ C"q~ޠ}#Gy>!D#I8vo*1+0鋟1Ojc֢ Kv;-=opOo:poZFoǟkKFd;U{#FWQ_C1 ="I@=G6|$hV(  Āv|EY E #6X|*4RQvK2RQ[[1 Gu{)%?~tUY߬Ⰶ0jsq$@sp8p8ƛcC&Q hw8Bs4҈6ΓwueJu ?}*Ưo k'χ]s nc25ذBr,+.Grllc>G/RLr1ΖT~=^jcTҲu+yhFpEt+y:FH0Waa$kNzB9"TƩCom%n>>2RMqK|1 |yJt&J'aԾ8&'ܥ23˹'7"q~ܔ䙄XHjDwDs͖|1`3|op>^#7q;q`i'֓e&c}/t\7f}3 \7Yھ#k ulSƦdF@ģ0}'^`78UlF`P0hA=S鬿a6q|~]|]!( ]DIz,߈xG|#( {boG~-ߠ Z Hߓ~ ǸDkNY_ahF3CneavoĀ$=!"9vttMo|I1|y`ͧ#XÄޜMΒ35Adb+fξYh~O0|c8 ߳8ӆoo9bp+W{_9voPm7\>!͓iYK O"zJ,p7g؅s;K a>tؽv{ v(upOV8OCR.]Ǯ aל]Ư]ز]s8Z*r;gpOܻvUJc-`'.YX;xA!"}`IϟWjLKAk=Gxmi@q4_YFkQ ׉ +}w ǔvsd4KХv}pz wpNd>]/(COc:G7$/塾_7t!_ ~GJqn7w!_t;f㠞8T"w;f6:\ب׬arcvldd'8>H-(u}!YRGHhtղ$ys|2Q-sw+U9 Ԇ/%X+Ƅ\(GN>ꀒjtPԫώ8tPGhubuՕag.ʃe&k] b(=rvO$Jz4OЎ6G=;N>f_%N>s.M:)zS8W>SΜ9pmq)^t¾?a}d^6L2RxN,<ޱ=C>:+qߑ#ރc|'j!3_y `]ރn+ `W7C1n4M hރӟ7tyn3@}n<+ :bn8m̮9Vo=.yg| ]ao]6h{c^+ SB8OMp'c҄ Տ5/&TI"kFNMU"v_]#9XY5#FJ]-2yf#8s}=fwDٌ-{}1к݄Z;#n$1h!ԄiQ\}DdJ^Zv́%\/>'l{YIvaWCߏc,ǃOܾT%n_#4"I#'okP/FbSY~I.a->Jֵf7C'uVػ8r@Ta,11zP3 ޠ7I!GvϹm"nj=a~#洨VAI۞0RXpьpH'rEb,_Jv}rеO\4dי/FwWLTɔ ;`Сg/, AL|#KZga[7X;[C; tn:D6E}Ҫ^) t9 sGJCl+sUS颵/7'1yG#\3Zڏo֋nᤴϽZʍ7~`$x3›]22r|c7C9N\ɬ ͏9C7;xP5I'r.1{1Y/9#oơJfoƁ8! xө'3g|C8## pNIg,T1ng Lݠ1mT8p~<gR\TIg²/DE`6]3"1G8g?MC4BȯӪ9oOVbM֜_ik j~"8zG (D}Lk G,jDi ^%`Sq)a&TbxuMZbӘ?r7iIɊR_mUn(h[6ոi6 4=袗Jr܏+:EwKxɝ*}O$T %҅F=A#|e H ZǚU}"Уj}PMЗxŃ MriU.)*0Z”yh cz,E^98s)f>4>[x I=CWNWٶ^{ޮi; 9hñƕWNi&LRh c_1n~4;r]1}:bPPL!m+R͍wʦ-c9B GHI%rz.eλrz§h^9tP"CN'rp,z4!gl]9=7]9Bx,5CL/ b]Yvg0>I_" O/'5zapSNC|,C}!FlzeWgnuhO7:t:vbnGuz »:D+wK%rW!\Unwn*6ZXU[YCWZ0ZZˇXKzw ݡT/0Z^ 6 5x8^|Ckp9yY *E"-WDгEyᾂ`xڭs/'/v98U9-\U8ԿNϡl h-;bv Qfwu2xن7'2Ɏ4Oҷ 3H_3 $KPCꤧw -Mw0Lf5jɔDVo|1Sz|q"kg 滩Q~#Nx2M祛L|nYm> (Gjq/rZBpI^J8aZ9=p,Y|BhUUeƫVHxQoZTJ<=|IJ_#i"X;ŭ s+~/箱4qaGR53{ӮTMЋ":t6a5AuqufH0hYW4isM(43-Mri hN&h,لT kjR5ٍ,w{Y3804Sm308 #L*΋¿xMR4A2D+h<2[*aw+ϓR4Ohh[|M!Vݗ7J&hIY!+>&*ssu3g]nt 7# -8a4m*h8% %&asWg(`@Ku {8۫˱"ǚ$LQ~Εbwoc@8Џi[%qrB~Ṉxq\fȱ{;FDPoݴ w0N 6JR/aބ.x eU(i#i2" /́f ` ٚ ѧ#wxs}S6d)gЯ/'ǔ 2U|ҩ L㉡@S(i5xC8wir,@ӭj]H Ug.a:x8= He% kԱN%ݍp ST7HSO:) $(&<ױUgza| F զ!Όv*_֣.K[Jl]D[!8,热\b w nkwv"d){rIDm:BJL܉>H /'Vӕc>w"R:!y6~ T.j][gnwZZ`S1NaSfzx8zUemxFEDcRK^#m3&ۣTY i'ګ|B;wװ9,k nKjLMΩ#H+ZLNv3P kK*Q݀ y:gjvlnYי~UҨ&ApBmԿc58OˉEhYtz|Ϊ"kVȡ@/%d$Eȸֆ=x1]fb/q/u/H?"*"n㚉Z" nފY" ]"tQԜ=Ν?lg@:>9=_~,HJvsȓەz\ YiL7eCmT Y$+yUm!0|;8wGp}˴_z^4Mo 8us+j8Tc:M'h9%^f:/x >^v?Ꮗf͏+A/B1MMvs혘s!Is8| C6EA<!vWqA?%Žݑަs*})/ݰa>cZ;L'εc'ب9$l,;6k*ڱ_\5h:e_;v/Jt٘'⍀l$_CCvp>&4p56^58Zgjk|iWJDߑ$nQ};1?!v Vi0Z2  GU\}M=< E)Sh(J]]bOhχSn W޸٢~hXʮV0Em(X) nZ>"'/I1F1˲^Ev/~Cҽ cVv+Q*T ݫED[3Xeo([7WA>'aTj!<a?TcJP7n'[ KN%_$Fc1V/b׳)6q+I֮ S}s8ȵmx„zg< 0a3w&9h7ҜU5f8YE6C;n3yn袚tL>"(9j@Pψnr, KUn6ԮnQm̸z O$5ɔGA/Fz{u~j }x aO[rXAV`_Phu՚C&8yÛŞ[GI }RDȰ9b2CjtQkeu߫τ~Zb/*PTeTkG*ì>[@9g^U\j- Gt%Lz,&oD?F-]ρ!]Z i8iXuvϘ^H)78DYl@lۻl@W6{ϻ1Y6 dٰdfp֙DV A_`N2H0$jl@i as*;"K9N_q3B:|ώ=átN; z,cw=vAҕv"2V; Q5;쬪d "suY=,u{β?u֣t/vi/%0,oep{vZ­FY)F*w%̒䰳 $vJTef$;;svV{0:uvci[h=c'Ѿ"O{zz6PƄ7ZZ~U=䫋UN쭝JtGx;D׈ֿ1dv.}'͎츳$19Ӡ1ݐ?7r=r ZL؛f&0z>ri*r:Ӓӗ#97\Ao$Y ,!Y$و&r Z| 'ڀc'%oOKN f(GCQ9ƅfs$8j1dJh}m{l]lF 4 ȥm߰NHL i~Ú[4 A#|VQ`;vDfO4x3lf1U Ĕ|ådi^rX1wnG~::{7Γcg"XuCع:Lxβ߸f~=XBd%c+SGR>AMp0z:Xp!u:%ՁЗزp Pl Z*{(e+p> q)jZ,-l,LOBj qٕ,įC#᜝aͪ)p=#Ө{:~q۶Tֽ%],۴,a;HR9v¢u]Т# .hm zy8 ^rF'@roduH{e={v{A z{A zp.h9qL炖a Zp=&hUڌx߰~,9,GQc;ψI/g{?O|?:0)Y. oYY[ς1Y' y#{*Y~YV*,]j%שVN~˺6~~ 5=C\1S=˵rm 45?rmSr )\+ V"~ȵvk%Y%ZÕ۟(r-2r]ȵMs֎R+\[@rm9ʵu$䚑R\tȵ\7˵%ȉ$׀Rs?>ste ZQ#אo9˵iʵ\>35D'Tr.;Qr 9>r$⺳\tȵ\sdkIrm n5$rm^Y\cV$אS1ykHgڡ\K5 gklkV*˵"c[[ZJ<pI-`'Ѩۧ`CH3W*2@BTmu_wbEqly40)Q @GrKņ&`hHtGl(i6|P7Z?q"!E核`M^kZwMlKߦ(m2t)u4/ eF=:lz'v!đq'Zt{B;[Et(81+@&Έ#R!Eaa*U)Q7tL~Xd):@DfzaQt`{sJk(e3\<{ʞ+Py<pi{9]=aS?p`3cUC8K:rΖ< bcNc,_O0w}X> ˎop GKB%z6jD7Р 8 jF@qn?Qp!ͨWx 5͖/4܇L;.~dAnw `B'yGH~jn)@I{$tjUs黸㫙c|<#0QHE[>]XCm(DRDXen苮^XIY-Jg"]8tE{)*~t9<ֿG9WJ8MMs9##8Mf4:V6tFWxaC̲*_Zw26γAU؈`ycL4_@'&QT"2hZt9KLjU7<c慮+{hXxUXJ) sG5J*[u ,89n-E=㋩%PYTzTU80Uټ  ?1q8uAr@ O4JZ`_zDK[%{^P_ܝQdA&\Y1J_T"5n?12N| C]3tZfNĵ1PR8 VVQz Kt}D7@ԱqR3FV%o`'X|{IN!W,(\z"EWzA MHEuAt ^7WrKa$Lj~e,1vB8[<1`O}dkGscgk;rM~7i52^Az8Um gō#V KMjncYۘotDS{ }tfn^zozGkAXchwGe;BGJ+ f >aȣ8rƅ9/ǖ@~vF c&5ewقXf96DZEvG WK-#q %!u(Qr f)V3pla:ĞٰW,l`W`a^Sb|o؁iri[m/,}4 Ef ̧jDKژ(C6!ci$ !}P0CFppM9ꯡU I<3Ɔ>t/tTbR7 }#У=^cԒekcCʇQc+J>i[UoG2qM*EUniYeS ҆Dw86 0g7> }tFV$fSM.k?,}ڝ,}gҗ&^VC^l ξ*}-OsLO2_Nm}qj,"2afZ4~FT{˝[7"V>:8# ݓqSPCq Lhtߩ#ʪL_:>I_xC/8~ SYl<ġ m:zͪB#=Môa6%?߿i#@Ř(!H4'K/hہǖ"Et8Z$k chEPf=J b7d1CWdS;]m۷DK>f\'4j ygҴ7hܽ2BR;mjiU4 p|\&Ҡ:Yi%Ѷ>xACDrN6"B4]QNJX/:Lu p Yq|`U^fx3D˹/u}"shGܯsƹ&[TqCUzƙ*u+P4m~f~Έ6/k( ^Zԗkf'YF1ڬ4EqM%rqjd(q ~F䓋Zgq mDK&*Y kM{E'Cߡ|1-y6jǒc3 uf>z=Ѷ/|+TvVucC%57jUldʰ~Mgy_t1pwʂvX N {`:co>тd[7Wk>O{$ġ ‡7t>‡:xưJ86&{̴3Ei~v8TϋA d\agȉ(9pw_㱟{@C\G p—aHY/îgCI!r̈n6\3"w8w;`.A+Рw9 cKsgkzCDG UQ7+R=QNQ;#w8yK\Y;KPF;Ywv2gOD7QYQm+5t#&Q,Cs` V9Wƞ9S/jJQ'-moוfw-:n /8A'^,Q.[lg+3|X,VLtħsni`e;b.Aˠ,?O(P&JIWK-ɚ"]8c;~ &!H r{ֿH NĝT_8æ(1->VOfQGn0gbyok5ËK>jIr0'(Cn<:G ˄a}kJt`LqYm?qm"k Ʀ7W'tM +h`J!z1]VRfc!&z;,n~f}h~A@L:+Scۢ[e)qh&B`'+Rx I("ߨ\Z84zEɗoWIXG n$,-W+hУB4VD]cRlAÐ:W@ Z~B7e)&ihrtޢbC qm4_I qfS8~,UaGa籖Ȣr# fJ=ߋPO{ >4cuxVEkJ:%g{5c{=QKF#9I2dxDDgz=ŽgT.1Ěl?,O"~?cF L)(ª)`H^ IjR@խo!o@:O-tPa-CA23%j+B$j6<^J1hZTx.~}_OBm"1j$i菠J^OZxCʱFX~u+#9Xnh5ٶgeZp>C+VQw;#00p3%rO݉npg3 bc49ZMyaky3Jl)FӌiW̴oPHVHn.xW5IQA[^-I8vrD.7tV}o.35]]$Fgo4lΫ뀮8АT&Gc 6 ^Ւy&Oʹ +O*ZOܕM&zL9͍(U|L#JH"r⽔+y9W1̉UyQ'I+[y 't IR-ȹOm̉ߧseФlE zmDA#V}n]-|t.Gg-a?1ۯ{b%$rPɑD?D}Sa ]}S9M,Y+Ϻ8kU$u)6VMcp@`8Ӗp.ޤxB=K_ޤW@w;V,b I KqW `#d#ܻ&'> Rآǖ:,ltCu~_e= 6rx{ p(}U>?1.ݐC0X%ޫZzR*+F4bWKfqAPzLmax"hͯO/M/X텟xE-e]^]U)O3R@cQTST۽0ڋ*@b8+T(wK/h \ʟVHֱ3'7n9;An S+fNJSTwd%$[;}15Oh'-(8\B/|s}Lt U4 =1?b(h,@.pW˱sƘN%%FP.M>HA.nVCA#o}8$B11J1D)0O]lnY<+z7o`ީoOԪyYsC+K~E&GhlkВqS$ѡ'O/z@;x_|s>Xx#o][yMo驳FOTqS9GKd?rSAn?s럯>Z8HKprMGN\s0am"E:vUw_ aLG/ڽEm ݵã-Ӻkcz][Pm|w>eVkC[5ܤ>F ޵R C]{ۛ8OGE6d\F ~S`s lSS`3=IsNmgۄbM+n z.B|I'><QOFBy* @n~V/Zgrm07H0aOk:6 6vĩS-+GǠa ̒< 7- Og4m84n瘆u8fh)lP o E5;jʓ|oLl_fc0 EU#Ç>ñyoxV_:ÌtiEC-^=mm'_4|F☆NJWW8w#2^KNy+a@Kt@#q6#,~xGu{,b33G#|]6@y.a\|یwo\mUi 1D 8kzٿ>GF~Xœ7Π+7?iHL9gZQ 1/ߔĉ1΁A'}g'|Ƹ􇓊8,p+?v8穟8EmWM\Plv(G,M_t!_ʓ@8+-se:}/X'P~)\u+n_m_7eCH{Ég{T.V`Nm37mia#i p݋2-&<4"VR?@oŮ5N"iT>9àw1rǂ`~o,cp9u:gXO%xU vvu8,CuZU zݴuP.7Gm B`!Jܓ,TXcW6dk#5 N}ᝨc[T\+^˯@j3lKcmYA't mpM"6-G\GDJRn[b3&6/mr)C&P}ԖmmpMmh XrVjU&aGs$*L3ׯP&O_[6m#}(hT&Ѷ 8_zmL$-ڭWrٕ:ɥTG\wRˁQp }:S|+e6Ңˑ7oW5=5۶t k{h㶦*^!_ yp9-9_:ݝ./J#-dz;[)ںX{ƹt8%c . bZG[3>|Zp)? >WXjZJ{2u.u~׀vXt.Jg x$3к>t\]a'N̄w,Y b)#vvl )%]LxsF!T[_^+%R f",7&e:#O/nO>)OV_ NlƞV?!) ^4ݞ}, 0@,'?6>Pk7 gK#,vU;\Rkk$2_'ZZ!~>40&MAw9_ 5.Hc%hc4{ TjmgTR?[6 ~u _3'B d7%vL?("­ǰڍ(IS?  n~TNH87N'r }8MkaB&6X#ՌX%/`S׵U jq~UXZ<Ҳi|,Z_#5-EXSASzVkZuTJۯiFQ5!vmj "Z`zL6-0#3^”7b\"6hSUY_H^w+T%>aχr¾ HܧYg pDB->40?BO#3_c&. Оq%h_C/a7k>.Ks4ñ_)&HD3kyJ?⒆8:-D|wPE MI/׶K#XGg_wFyqWvLD;@@|RpAt {y݂(ZZ=gGF>=jCuibH/u`tRХXX7;Ʀ߶U͈.V ?f#9lGNqpsi3G=B ҹ@q= #5=! C$,GWEm([tɼ'M"+0eZ9 l _0q;zZF[,Yd:BJ`ǰG'$ L#o;}+U9$)aໜ4=~8% -t0t :{WDe^hV'f*EAN͘l3.x@\!ՓC7B?%l>cIloNL؊T&_V|,`̏V5ZѽLbj 36ə@ Z]kSi݂F&xxNbϣ! .elݱQI/^b_]ېt{&=q|9s9&Fmf~LLRuYMV}qV" ;2ȵBK ΃J4#ܶ%ONbOJ`O |z\QuɩdA wR18&VMOm>&L|БURSrgNOl>\Y,`i^Y"%{@M^Y48-\z@ W^ΕW{΅?`d]X &@Rn ,x!>&:g5I( #OsXeBot;*׷% rТ@uu@RNk0=xa, 9sJH*.^GW@V8^+s]<w 8BR3q>^J($羁EёQG"F%gs$+$kk @8[9<I"4'[`]g4t3,!gƜܼ—~Ci\ ǟG/8oܞ-|a4;\<[0g>F1I uCs1λ8Iz~0g$Эz8,잓8wq"JsZN'~ιs:[-@3/*@Wt 6NqT-h)ypۺ+A οjim…HclZ D\7<:]R;: }@8b"p׭3ցD"~xwfoFRLO;Q迨_:t:](b9Ձ8l XHtre j4سDUֱx[邙 1 y oN|շ;S2N79mb٥ɕ\N[գufw %p1erU!*_c),8Hb6-b61(y5RFL'gz;'n.Gq7C`'թw`wәQ4+ u7fd(݀ÿiAx<#%wwa 7AR|q78wUϣRon1Q 8>q@i8"h:n.`9V91S9 f 0Wݘ g;``"DG`"#m3b{' hfiF6"< z O X_sy_$h;%_k2&20tA99iM =|pCu#mh'*rMrKPgE%C5x(Xٞ!! |q..Έ4r(&N!pa:G@b/GŔ3elq cqT (JL C< KXXBi/ iG}0VaYAS{՗]ؠrWD;ztŨLWGxe!l=ZJtPW ~#XxcؕMҕz"8f7ѴtP -/WBaH2eJT}C O%S%/N4/~/ܞ:D_F?GOP+/߲cyM0(%M+f9T 5VŨ#fHm8/AKCCxn"=~i] Zo&R^CQS"u[3"v׍hgV#&\ Rr7i7cGjPeLB(LFP[ xTǮԊۛ/܇ARD`_nG/%-ģ%qϐ҉W{K]*,VW]̅ygSnMPIg:F7 k3i(P[ue~BdS} _\Ll Hp!l*_+  Qg*B*t_IOM0NIg8[A}E-8= A :?&ὼ;4 턷( yMDnv݂딺Y!02} .vh wzRŵ 1/Q7`|I?0؛twjxjDˡ7~0I>܆Xɞa5Mj]K ]Y_ukt9n !&aMGΝT "优O)iZWwӴ%A mo4)^t{> ;DlD`xA 0(犒ݗˇ["yTѴrq+̠~&6~-xE pS!H?ӫ1KC"kÔHL ݍN08:K9hӭ9h{[=~*ߌɹ0t7iM_x72#5A pY[`PTˡyOEG2/zFJ{GՊnEw ȝuhJ̯W4h&檾{xЭLH[XgW,ac|V&Y8W dӶB<0o`@\ K;JVLJBM%}*'KĊtђV!Mx dNWq9{J&kFB !ת.pWcx {t;v\vAHgBC#s.p6|Zd͵4tĐsWj2=Am6!{T0A$mԟr"?)L)TsbS.p}RGy.p}B4Ƥ:lCb8>SW]l`-ƈ.pĖJ,3}5i.;q#sTb8W V#}p%k8=ˁ=1"v}YGޠaOye!d+#sǡ`e0-@CИhm5T@L)⥏m?P%\O=5 <*ݾ>ጨ$f hl8rAox Za^r]5qII Igif-Io_EFV*B+d+ZY?WwgAWŶO}`ɂ0ӜI ` ? RcK9fGUTqf$;hF7%Tj˼L/' $VJʵ tZA80&9VL,DY젧DuN+C8 M:CbG@tTAuQ8=U@?騂qTa'i>4& tTiW:$GQ/騂akGH e ?*Da>+ zaa"+m0_94 Ʊp_ IV0VPtXAT0V |h9C'mi|b4d:$N>+auX鰂au簂 _R}ZhtZh{Z itZޏJ3&cV80W"8P.ԏN+͎W$\Q_Mx ԭacK 0D-d݇ky%,h(0% 0Ggz(s&[[F/m[~7\ajf@ ӆcbC#(u0mZWUq#nC|\]n(@>fy:zT_:?$Y^'\|iG@{MaeZV-lNoTI]f +TqUhGc|Tݩ䥣)7DG7nWE-3ٟ'轫_\ŷ|CDg_NE*X?6<Ѵmţeve% h_% 85 WO+`#aȝ;@Vb1V׼~vMpj%O&${xﭟ&;d @ D=N{o%f4A"Ps؛O,^rMoY`Q_f:F#8ZWqgT%-[ i3T..u̸*O3#KwVA9]U2EB0L}p4#\>8m,k$`H bEiT]z/y1e63ߑDېch:,r4DCVb8n;]@5SCZH,3Jv6S7l~w_L`gLOnu<]G"FҍRFr|'C\G 3usVvq/QYbxQ#"L(QKG;Yji!z"q*j?#=nLyb#o)cwS W!6J$n=)+lDx]{h<22 C]7cw8T+;X| c!}`νe / \ Vc1J,7,Kض#E%B^N%oJn+UW_o)K,mpHHP4Qh>)&78 _yc⮝H.jNm{7tRҚ3wğ0FX*@ 3rž}g3K6b_{6BiIJ=N3*ڳE(Ѷbڱg#ƣoETسg l}DC-9=o~|{!r2CV<^?Q5a(Z9ң|qHWU:؁ydZM'U8#8IýVRiQg>g+XFl7 4P+%s*h7pwS wetp!z]px3 w|cw\?ֽiGXmum<qF>.}ġB72ohȭаȎJ#RHYRN;,ґ7R79H!aWG)NS옺GvLzA|dG}FBE(-Wŋ p=áFuM_8Ȏ:#;3#;4#Δl>UzJܕJ$xWn/Έ4hy{3o]=18̹/hjqU ƴ[JWpnq9qY9$[ CЧ]5*6"؊rd%a?.K֒\kSlK=rDpei{QV};_Nj#w}vJ+GR~nB.0ne[ j*0lfg!>M[% @W[ ?2\ajXxlgZ <^3Eӯ`iJ4wTCFH}e`nҲ\Qԝ9^ ?}MM zpx87^i\eSwjˁ7&}!7 ץ5L.тmR LnbUs.`Ր:v/$q59qb ZTe8嬚oXөMջp}ʁSoSe}uX V=AXv:ˆT"v>C lB0k2-Ϗˑ1J\ M& . 8u'x|?oXm֯q]@#aEb;T3jG$Z"- /&yK4ռ sݳLVdZ=8A%s}cءW&h[pG;zCxd " GJn' BsΡlGͮ2lin:^$W_+<{4v݂2= S䰨GV%F$5,Gp,:L_84f F&<򚯅t'5AL1\۱/D?2HiBT;ge sM~]iϬ3=`rSW% 5 3-V^u'8?,3WÎ/mrF[Ά ΀? gw a@]K!z~z*1"g&m!%aQCKWX3|j 7:Z>ָ|Hؐ@E 4@e˷/]؝G\˥D4gĊW`z sX!Wkڦ.Q.㥘ZO(PV ш:-;balI@Xr JBڭ6K(60j_AB{xاo7T'y5mxM(|% $ّPi'DkL'^l=p,i%KzY ζͧKLJN$ؗb b=e$pBEi FŗY2rFZ*eI=1؈Qnޓ:nӣ+{Xh|ڹ 0"Mklںq{rL?}mAioJlV1)Sw0N8E7 :vee('.sU7X~!h7h3mDB+ L~iu]8S̞CLz:4O;(rF`ٟ9ܦ*'5V5VTRZi"$/Ŕy5*q g}`N=4LCU8\|ú߰UO>pZdw̱elhK'*mh#E'"]E9\hǭaE؟% dp@ZC6׫kN_ݓEz*uY]D}jH6EhTssKKp%VBY`b n"Jla% zkm7R3g N$1l5?dM+~AG̗a0ˍh]WO9%X,7+Axk#u hg(3qmnD0{|өBdT1zs,<9#)m0a]戮O0PU i[VuS;~h"e)*w pJ _kě[smZKROe_lk:h ݞ6[Iouvr-ƣTQKf(">7 4_z9 h"" 28xGФ/d(zG HQl]J;k{Ҽcpϕ(c[DMΦK>:8YX>ꀊՑf8҆sZ=;"Çu< uFt zk cVB]N< 6aGXíY i(<ßT  Tfy%5 :Y*Qݝ^mPzzE=Ɠ8E`ƶKEfU+[fG7 Xݒ5kI2*GH8\fA@awm(Д Kh' |pMOG`Lۯ\S}D$4Qg<~ ׫Oظ̱ `bχA~d/&Akډ1Y"OD(8Rw [v;qִlEW"6؈'a_ߋM_rb/^G rÍ?[}u+ڦ,b_ !`NّJO::8$iYQ񍢁( 9KgW= *cp. bm% BtS)l'l)|qZr6Cwq@A\ŻaBODNH ȢiYi/P_tʼnok1oT}^vE,@8d 9 lTpz|w o^=o3Wݹ؊yw6{npJ,S͋=99=m,4>ճzbE*.%E ,zWv, OgK<?+TK Y:r2ieE{!A+CyΡo#s^s>ku|S7g֐OpbL']ųTAyMgxFd@:=Kzn{Hx{(r ]=D(iƢ}ڋuL[ ['yИ߼zYzQAWzc|(>{Wϲ"u.Vdx^>wͫKOw'_'pP!xNw D̔rЛp _kLń*u7B\eC BgUdr~owpojBh)5/1twZXNhxdF=!L[82y8zZ \;/n<ن(yJ,*㊪MhѦ\ fop8esXL}5P*֒1h&=4'; :KpoN3^SUٕUDKW[.2g0`Fz1QߔG&8DX,CC^'?)=q7oɿ8נJԗ2݈ˁ7ԫ7yΫ,]bWXvG(zY%*VH_饈-wA&X䢋m_r4= =4D61U¯rbH00{DDp7@YGoO WBb-z!һK|'dw(U^NTnrl-3/L-?U5;S%W:s8ZP5~1o70|#xzr4Ҍ޾c 6m 8N*"{}|=@7` a8UxCS߰@Ώδl,V-Uyr?i]~[ Juy$E(t\1={Sxq_<zGuzs{(n:`6sVRnl=%|h K+Apj'{~>iE~g9671s-fϦg$ Lإ|uJL],7L9ݤo|z=z_Rd-]:rFvI09Ojc^;7:.Y- qN S6Է.J̗ Ȟ4fH*4B2xtKn/I]3R$4VCU1?V=K1;vIoU?uK+GYҮۇ@ӤPI$-\!vZ36࿙:Vo6ȳ%[VxzpP^D^DP-%_grQ7lU;K yTKy^Nc_i2e*<dΔ#l V{##Ǚ\}T_VN%}䓖 / 53.7Ɵbg 0~CWwy* LaΈ Σj`Oe N6Ve?Op J<&tdnzzLLMvL;;E ~܉O˹;wEv& N{Q>C7C࠙pp-cDvT82WDP p#NEoly.!K$8|HpC(bxlz8" crx}V# r*5{F`}(("]Yg_8T5pu% FZvz[n>A~JWL97IgTyHSmZZ~f ~ ~9 # n JAsI,ٌ9XԖJ8͢%8:64,{ZnGgشߡ2o][vmFrWaCiubTBB&X\ۛ~,mh,.sqڶMյk0W=9P}S5<Z1Ņ߷ \\_}W:׻0[f8 ֱ^ܼԻxm!w}}U3Z哚OZ\[qiqe,e+軸k+fkUYønCgUGr.tZ^by &]^J%;_r=pNy3Y9p2>O E_|vU9}pSz\DdDi)_QofWN.T ~-E'a]2nR8i\H:o_r {߅jB sl#U.PPaH_ZvyCUʡv1[%QI+{ +ڥe^l9u2O3GGqq**aC:{X)Wdi|u9R-䶔xKelӱ`z{^U NR%9g3OE ! \z2@r mi~u1+aM~Hܧ~lXJ`u\=Cq$ouLo58CΜeW4ά\lHBdMFSbf$W ±3?W_HhL*pq8x'nزa{q2Rq_r_Lg ShIo:.j[m͘t|] #ͱumQB-Ј`ȹVݟ%I|BQ^qnL. QbEԼe'Q"XZsrZK ;8gqv9ITGo&=F`KGDǜVaLwA}B~,3H:;JɎt eTJs!jfGIp_ٮ9$`c dQ-;JX5R#r@aѤ[A\(Iiߖ (IgGI uV3Q>uTu̴%/ڮ0=$Qh'5w'Iz$~Iqmt9ǫ~F~v$Aw?YփJG[yn~~$ٯ.>JeF~~u$IO'9SZ֬Vg <گ$[1$Wպ~-Irl f| L6Ȏ$c]?INǼ~QI'IIIjrVcnIۄe_?IAO ~L{\?p=%`& $ġT? ( YJ2܂N=$h6Ykeܘ+0zߥ^R$DZ9K<%V1~%Cx`Qx owꥹsϷ$ȓ|8GAlRe5dٯj3.HE`xڞLJtN+?pEpXʇ+؊EZ:P+F;/NoaXk6p=y9jL̹JW$zo ǯ%2:}$`ACV d 벜Vhۋz֮WIB%ʢ:Qi 1'iM(1K l/,:@!8/@C]Lc(>B0>V ΪV3<90V $YIgd4[C汌ux0jP淺|NlSڞJdIl~>OT._z'F?j%"Ao1Fz6IhM'Nsd(~HM,J`Hr*1O\>:i]GB\GK*L[0,+iWC=-eCceQ}/]H ө4y5\/'" RL}"pfMhĹΓB13S(Mx+Yy}y733a%AŮDN3I+t2E Ig;ۥW'@31 `󭌣/B80pQC~ R-IV-S\ -%t ?KtkpO㷰મ{8V.  VI@S%zѩ1hpZha0 h:ʎ o2PA šл gv ZˏW-y$- y'7Za~ ȋlS>~ƌHİ~1"-Å¡u_u<.*#q ;xrk1!gwK "Ax.%fυ<>3ժ>}ۑ>x[&_ޮ V!؈I|w6V8YTm\]R٪F]=k#ƥ}%u}țf%2U5?@*@$Iه>$Y>'CeuQwIaM~~\׏5}hUb,LSӅ^&ObZbָZm].~QY׷ ;1o0ģYV2u}]轅Dst}N""(Qn8ę㵦+ >4u|LI鷞o'}Ȃnd9ɑEz>PW&;|A%f&5/LMhyWJn+8y>4"<ޏ֨SY;BtaNG`<%c99j+ON 8տ>'RQ<7q2m>'&8\ U@K2dtŨy*4Փ42hu` =nAu :Flr`g#J hR &%M_?סT+it0&=^N,rdGCf_UigG!B#JDv{*24\uPŧ[P/ 0k~ -2êz6ҕȾ#@P.?r#%5LFG@JA n5LOœƻ>Jo7Яyb=U(=f]5&ҭK7s×..wR_U[o$40_XW.1k1r[8{墠3=p9Yu8mt@=?CNxfW89qe!hJwġS QK(NõhPZ!y v:c(1[cFr-jN:?Đ^*ќbaBvlQtv7"Z#Y!ށic(g%68ѠCאaQITCbWelY+J݂_2_FRQMhD|}yy}VR~I^lK1Pa Bm3@5$6Ӟ; :杕8j8qg_~[ )= 0KC8Pj%birWV"}m-~kc1FZ&^;qkdQNZ@{om*4=)νu8BB5it{vdGgָT{Ĵ3\mMJ k}sqDj`{ˆWסu8z//ty}q֎M\gэg=bW3:>fK+s8!o3:@Dn#ar?I ,9"&@L%߈!{=WlIo#`Opreh3xXT?#0ά_ӡZq`:4Xtߧv+%T>41 {qE $zDV @~pDJ*`Zo .@A"X^jU[G~?PE8h*,xk~$=GCF"53rs$L/KIVLފ/nos+"މK/9'}*N8+p%#}r}X\|16,y"/`. QCM7a;V-{@ 1?Uq)Z@Oa6sbLĹ |-9&Dw_rJ︃k XCndA+ w(ߝZ;J?ɋ9EyǍq7qw\b_pHUk@@vpqQbEx_ՠm>~CnLCp/"4!pC"*j^{'Snt,Q9|Lo97rfnQܡ[po9!:F=SS<5~̧r?Fd/S-}^rD+{|.nPwrB(i;R!qqV 4=DwW3gM\|~t+@ ePY~G-C*A7Ӈq|=&WgMELO≯g&POt:1tՈv9KWruz[_U˵}թ=:}ٵپ1oYO+*)/03qAju٢U8'pN2돜SտD|9D xD z9LJ~"_aKQasF&bb;J|pM]r"1JEnR_x8ְ *1۸ !Ű3J8!3sX송DΉIYݙDės')]9i#ƨ]_rH NTNCޯm ޶>h?GoOuX  \ldHXF$kk%ɒG=шn 娣Uc6Hş(:?Ø,IilMID3A kL x<^ VI3ʢWoD+(韾"vwd$c+GxFOGe@Է9êH ×Ôd \ Tp:iwN4a;,Gstb+*i' dw1(H'LEZ5xKi KFұ9]B?WZsjXU"'ܷ!\u$H' HO% @ψ>O躀^u]_w=8Ad9/VlDT`vUvOi$ٯ le^{կEnVDDZ)݈ 6KQ0=Q #E,}眫7?Ҏ~)8Ksa C &3ɻAMH@S&H2ܙ?x#!޳#J%Aq쇼:4u$(6"0Ϛۋ(|#*%컼^/8c. _Ԓ5eĨT0+_GhշJ$1{8}n+b(kӧ2G/>5>w{`t8\(9חp.ʯEUyx[%fu=OG 6#vnrdK_o&[2sR[34"br0d\R]#(X7GL/I%B'9.u$>;c | ]mTr@,~[b_M !XZ? X GdP9b㡄驢/:_,c"׿CzOl g8aGw+wbznI@#qJL矔͇#m/~e7=Kax&YlEzy]J ǓUvB9 `]cu6؁E&+V.KOˉ_Nhn:"Of9n9NAۑ?x9\9ٜm<X J#󦿯ov ~h&-i>ˤg#>E_;mLu%rġpZ~8F%h}B9,yЊpj7q€ƞOO~[z݈˫ jm3FSG[qF,w D9=&".ˑM_uNů8E@'>{I45hc.nm_Nڂ$Y߶SՍ7n5 |Hp:"9Hr\aB={Ћ3^D'ٴg &:_%HuLyFL1O/_Tu,үъ~ RT Xo?DkTb(Z8cF4<94!QXyq| {Z3Mr9gH]y4EtJ*IGlo!;;n;Cg)=XW`n3py gb5k8Ã=_|z8jT1V:GW4Qo$1Z;xt3Ƙt*~_ GJπĩ&3cVrw0[?8gzZG z|긣VV+?x#rvEgʿ!(c T#T5B3= Ai6}+s/tH,Ho#5*0C 3}T` < GhL=``3Q@VtkY%Yq akpOs VÞ_ ;t{aѵ=!2lji!s\ +5IKq wS M8p^ږAk{+,= >l!X\FvB:[5÷J,a͡CCW)M+</B. /ĩ4; ::;Ԫ+S{o;j},Hf~bFY9Q1:]gv7g[^v퉥3ڐuZ؜AO^[$Ej'L,.´n" pgND- 7^]6?3C.qEhx*-XuX~QbxqX{zQvf05nWvAV@##wnH4ވ*PPRްі(l¶ˡ5Dd> 5Nt@=XE)^J.n4Q\EYiFIvFնT6{YRmifYC<~B=F5o}-?sΏ#jƹbcԝ+{K +%>z#[Ix53Տbxʃ-Zbm*qXlhUʒ+1GN/p~$~mݔOE;j˓D 4 Y x`|Lt9[tEv8B>oMէ'=3:AwWi.-F\*M٪ç&ZgN 6 vh3Nhmᥥ6^:zg|!!#FXƟz$N 2 擫GJ`XSdAwبg|b6b=F8d!o*2c|]|ֳ!YxTHfEnه>i C-ZϦdy Jg07Jz!giIU EkF m?m bO=d?_p=cH5nIτiLT_g:y"|j~z9ÔVBάrw\DzĦҜ{4nER}ۊ$oF$hÞE8" u0+ރIm_9:_R7hN(çE>ϢDNƹQEHĆHRW(=pV'ȃIpT֑z$vfGwHMG:#'+}gmPrÉq~/2^:Ap C]OC*㣄~.|IxdNz~APBk5n|C#Qt+y$]r~Ŵ)J,A]s7:*#bY!S\+9]/NՓz i LTiã+_< &o7R=\AeBg ɷTO; (m.cI=U ?s3é{N_+SXy(6JHS/PWv\_\6H=q:-}ER'4 {ΛJ@c-`v_lzF|L'xp^!pi1ax KlTwDijXm@.YM~f붶,XLq Ya"kArhkZ}̰(ܦ_d+>̕bMzH1bq$] _kBV#ڲG_sǪ#l8v84br9Jӥ'\l' rA3/Ѭ{.1,: [RC~h䥥̜ojVTYV뼢V^GV1?J6>gg0Cb.Pc's|Kgx_}@ΡnVΡn릏ΡnyΡnڣɻU2I7}S\9 -E+9WjsHf-j|:\XЌ:fts`WzBB{]p>wg]Q]Q]t'6<a>8t2'_8U>G;Y oISJxq#7?NˎF+zJ>\u[/Mpl`b3H?7+ڛ!Kb6% A L:̬4lݣt;Y4jc(j`ïΆnb5C K I˖~0@i0YQׅ ڌ"YιsfB@ y|S+@ Kˆun V`Yy;Jdy H) ȴ%yB#$VaG/z5.% M36c<`g {6ic{gi +ٔqC#L\Phfǜ})۶#C?Q~ C4X%W>;::c+]9LӒC+&ftiNV8&0n9{%b$ 1V4lEm|p~EJuGM?pNc(#^R/sàgWo&:JJ[2t>_Pw`EpUή&&M8GUHPT߷åчD/ 1 QhD d42c&nˏK* 4;h  VKU s'U0]"Gs"G9402P%߶9CA%4@W%~:“V颕|̂Գalؒ"X1ve.ۍ*""16R)`r7vȱ`MX;ȱuˎD&S k"h"YExT֕5hdx+n(HH DK#ӂ ? sKpۊ4.oGʤK^Z!\ C]t kkzaS0_HO:=u) )iy^TGk:IO,(}G|=3sٲc$doɀ:q"]?)O sTRYݴ.y^p?Ud@CBZR~{<4F]0# ʹt )&O,}3zek]Fg>~^lsΏF|gD78WCuj2FGc?d$MV<9": DtJ^e.{/_8|hP^ZSG!#G.at]ܱ3/B'<KI6b5D|%.'`|HoGq8lR!)-r ńn zU\HO $pw? U=L' |#>Jj ;Uk:g[aDK%W񶬙}#>Q|$"u9uoyz b#k`7B.pȚ縤j},a`4q"Za<^{yӬk𽽽\FL@r'b1Ĕ'K| n^ =}su'n~aܻyJو}n42\p$# [pߘ}oR^(qwm2s_ܻ}b85d a= ko^H8._Hn w}8TF cma;$w01>Jl1LvE%}"8Vr']u@}/6Yn90I)ts|2`n-$k(! BgjEUKloKT*df#,%^ٜYQJ5u j5Ї{Rݤ"IiǑ? a:gpY VZc:z%84p3O Tg PN f1prd:u'ꊦ sБo-Џp2sz.1F,e<جbx~8yu9XL1aW50UX82Ej^JL0K%6HF|Kyc/7"%)R7C>w[l5U+;jBKsmD`ot_cm.̋0A3MtG5#/[2[4sX%ݓ(vnAQ3EaTEA?hgl[ 6hjKޢO{(yC@J{{-*:ޖE8RB:FF΢L;s\S ~aS!w?t[[$[z-J>΢ k(i9n^^;1-gE G4 N[ "\N hoQsuj\Ydž-ro>)y)-nt9e#ϙzs]ꀼAȖkC]-MOFx^,WD˖djb?JXj˨Zc4˃nbE[0Cj9i,ةIJj19ce>z*glv͜hKQŮ3aG.3"̈́ߛ"EXFţGEo@GDV:w+"y`8?@FY GNJNm5d#p|Ɠu+V*tx> Ծ!c)F 5i+~ӡ݇ SpV<8Ͷ;f$7@C+~=-~PWInP gp\ n]ц/t ?YFEpB%:h+%l/Hg2B ?~bdq Zl|#,ίR-*w(sz_7UUv~!s#B^^yS:XI_5.+Szq8i%5хD' 1QhD d42c&3}nh_~d{^}?v,eKBS QBT[9kg"ig{I{fu|se@$TX9__[1skL1t' uz=~5hGC/٪r@=nQE+m䕝Y>n7&:Tw( \F /"mLk.C@"&;n㗍|/s.|gҒ-Nkk{J a2%'Q#@73Ob *GZZ>D 4`k=e<` e49=Vav׿L0\G H,@HY[5 >,T&SQKaU}(Mֿs ܷ(8~eWr8~'uñ Xcls ñȳ ,o׳ 4cXg`mI,c=ȱ+H-yg\2{>Y-('S 1O,Ә_2Nɾe虞YƾYN `W{ʳ ߴ,Ch ݺ?zRDҩ5;Ne_eϲˑgJ:q%xFH:c/t`#_/ʫ8o8q\u,LeyՅcY;//_;XF=+#\^ƃ"X8cd S&࿗s @G ݯ53 b:h$/=m/Ya=ǏB%)Zh9ZRA&*'@5Р]!{^7up= I2Czf*Q`}m3ݤmedǠ{>Q>'/%Lݤ8%VD[-o_ X-F-w'|%f5~~Y-xXfġZ"qxrs.Kt'#5]?0G-\81@4#*aϏ#w6~剻;58uE}O ρ{g=I[`ݎn&1,Lq9a,MlCA6Oc-|㠰"U~rdL7rP ԈY&^+'1螏P{nahy/jĀ^\zWUIa< oO`A>j4+:@MLp8 8tMaAHUqd%,B]ܱ֥2ږ7"8-NG(IKfk穑"@޶#̀W?wtO@80M,TeO१ҫj~UÔȫ=hg*Z#x[ޣ~v{r)ul7o80I۹DBDH x 6AfptdC~H u#y;j}m_k$cM=~ cwsobtqקMC5 ]Ypv1#N%=_0Kگ#ц>>D$K۞:X)@ֶ+ MIɞ[7A݁ xQG;KA:FjE.t>@q`(_STn 7}@(^!}צ:=\ hAEuP8SϏF AGg8~ͫ'\?c ;]sĘ^9+|̸poz9]nb^ }-x 4xHنU%BbPItyhخ؂sc Vmh-ll0Hp/F"zX"ЗtKխQm6]J|8m #Uy SU]$v,ܛ*O|3bJ_XKP X肩~QoQW K{J|eטh} t]z(m,Ǘp'-f~`ܞ_:u$lWlO x~jr<{J*u 힋E_3Pț1B[!˥GR8Ԣ+ R|!$nltDn-MEAC/)'_(BBk50[,E(-ݧh.?0_ An JސPFۈ3An\:_:PE+b03؟qe,0` 4o%7l#pH4]ѯ3.2ɼ┡_@iBAb*()2$1"tIC_ I/ٮgaUxc1DʎbmO2@3\O]OE:'s7>X>$/CPru1E_Xy iky{l$N[vw3c O s% W<>Yv!Hue}Ac[-` c|hХ;eQ e@W’X8;k[ht|W@<`x 1 ]c~D0\_ &iP-py"R1IJ.l^ HcTȗ+ '1Bm Hep0h~{$bzZ^\s!ueA%EY=HRl@~4f>Y3^ˆ}@?h;Yb-zN "8j50Z߈@AʷX/B^qgҗ?AHP]O.(EK+ Ӎ}yCbQ`< $9 Y aPŤ#ȕ z WB * gpb1$MPE7 K`QҴ쑛*?w%mqW'Lo25`DF6}jK*QavzꔷܒKbRq=+ {{nANAזĥ,֟_HKI\:CvE6(17뫀g$֨ac'n|꯼ގ Cg[4[`ޮB==0M{w|(=NbO%b*DiaY~Ў7{`m~akc;}u&}CZ{*}6o+ޭ> ݽTQCkWg_ ޗI?t'fDnAk#;T)<9Ѱc,mȴJ6\ok+PtH[irv L@:' ⦣8k !g}CQyѶG;s%1h%9˵ƥ˵ yo k$%wV:9֌R8?rb_A挓U; ;)e;IkS;bh4"/[_xco6-'({/L(ϥ:Wp+`l`gp-bc]:+kQj5CGrn~'9Uxd-2HnB|sc~ܵKwR~'Ŀo<zUJ&I1-$UriDcHu3r3s*ƘNv)MTZӟ/ryaiz*\G%mn;ҏ3UiRfxw* T>z Om\*A Z;(2/n1ъhl 03VFuRsXW#ǚƤ3䝭I<]wC+Y/KԞ|:x[Qs[yX3@eE{w%5Ι$wɋfږ_u`F+bس}s"YuM}#`b_I.6}r~/gP2_LP}~.W .jWN-LgrW_ F>V?l].Ak|T8ԊjA.yi]:cŅV.?2-ӏg~xH_(Ԗ:<uc*.=8i-T|bUv\;hQ zK;08 gչx;~3KNhKҹ];aչn:wBLY:wrʯPW& ;GV?x pƼ%gk d">͝mʸkK~ ahD@ fN7&֏%Hρ,~K~8~S3#w 0B9\!ie>1TjcH^2uaG-kЭKjv,2I-npj}GgA0Y?]syKUk;GCh7;3ys ]=ГijJ{m̈́gK*AẠ=u|"xA#^V~;cYWr|Lw8s_Bv$pdA= ce$pz `c5R9nRys=n7ٓ@ߥI_i]I/ǞtcO Ε{'¿cOؓزA.IKtu&A.;'szDaWX!bFaN )aN:,F2#OuA5?R<ߤg=ϥ7cҵ*Z5Gk$Cϟhzq=tʥrCGF{@v r)W+9jg r&78WяYAEPP:$HRTe{P!AJʕ^MGjM?դud(K탴pr $ r3RR#S>^qlsN*1~R3f\+%Z89/'oB󹚆p.>|"L*)uy~^PHZu&g-B^g-&gʘC!LZkr~8k499k$99kRZ$g-1'g-pb[HZWrh~8kq'9k 8^HZIrgg-6"9kRJ 묅aYYKYY+~8/g-6 9k}%g! p&gnLܧ6M ަ s۔~+ߦH`XJrAE{* ^-_:ɗ)?h6^ I .|nhWsi4Ew JHɪ5,>ġŜ_`%c1Giզs{F9ig9|*12&;Z;*xox̡͚wGhi2k(FhAYI6sW~~$YOñfsP ٘WX&{8g}_|H؀3'bvZi1o&KN68ymWhE _Iq O28Q$"TO~L~l]r x#^ f¾!u'[ tt#s ĩ"FAcyxs6 P ik"-όqWlCGסjcC9H|93U˳G0/X)ED+Br// K SB]щH{UCŲ}vOgzfx}I/Rn\ܮB# ꥭn֪ȵsb}gD_^$tLG `_c؈dS slX8UŎZU:NJo[CS{=ɶ'W?p"8\!t,X?@P&(Hf& mi {:ܵ4yꖘVEj̓z=΄ƴ@:ó{-:{o?In#ow5xS&$m24%@{"fБpҹGΉk5V(,|Gvp^!j?JmY("9TcˎBAww.F }.ZD-]AwxoNZ͓H?png?=FZ7eXNJ0f{":6;{O%5CVzpBp-ƞSzKvC6Jwھ =qxojcF/&AN c?rk|6i0CoozOH'UzK_:^ۙ8n䰪n4g#U&Y#T\2r,߰_y9*=k~Ls^tǧԈ$ߟ`8k8Vd@>獾٪@=/O"4 P"\Q'RiȠuMœ|k(^dw$EVs$:M ^IZ]́?!Zns &HR Pnu:/\bD }#K_rХ\EV#)06b_16r'n7L-%~|u`F+bӡ)[ќ+7vI"r U#qe"%8i<%4xrrHP=v^3 6iP65!vY$m& kr0i G1&g_q  D-\[p!ZW! J8Qgz# liU-? |lR2+JwF X#ok=eT8j>c;,"O"gp^=F%z_Z2*=$*5*a1w(TQF\",%`F U#lFF[q\t˪D`1S͊0a wkzJ쭌_}Rt; ۆ2 @'PsYμ<9O eUY}Kn+wıhAO%׃O\`/Z#gwbU)/##;bfK,Y@ BZm Y:7Pn| ܏@!Ȱ{8:` |֛Ty.\w6o'y 8g)W3޷@vy-Qks43tecPJ# QGF5k靂 jկhP %S ¶ ~03i1p, "")$ ù~[+r'=Amv8;6"Jt-c"Y$z`&839/ 'lty?ҧ (R0+^>L \/Q30֯])ғMړMY,O">= |Y {Sx3tps?c 9m`1l;|PWB%Sq3{i;%F7U 9>"R1d/ʕN8NWu*WRoqΕ_P4Q0W㪛;>ICiY#5)TI`s ]tL%W\"q~:Ig-`'Ibu߸T~t}K脗s#AϣȞ@o[d_Fpj`A9:a_?; yv~2tyur\#W:VՉD%JՉX'{]F ;J*|âqޜW~}lb}7'|ù\oN 8p"gx[sۜoN"^X`j Z9!%<9W_ٯz%zYh:3ߜ=/7'4E\gy͙ys5{9wC#^r`GT_fNtV,Ng|c4gG7nSf }|j'U%}7 jFs*¿=Q}{XyU{1^+(u}DTu}7ua_ ^/Z$nO⿉Po@0HVDQ ~?$ 4PSS08l /`Z&苜y8NW%)ZiX4ә'`@/&!#bC( %".a?qP h|+tH3jt1Dk & [L% b ZٝUmy) * oׄl>:xj=gծ aogk%wj3`jQhƖЋa`JD}SmUi60}=6B?5bwB%k6FG:`G}aN:;#_9oy|_5.rn8v?.N0$p㿜#a& GƙTũ38sf;&ᙓd%8Dq>?( L"Ρ4dO+$E#~Pχ3ÿ"\'%2õ>J\i[Lд'G_jq ppP cq ]1Twr0]k.1[s<%9=Y/G{b:'ٓ0F no A-TH Qb4Ѡ_WoV!N%:4%L%7\ Ql0 9I==-jpMo%ZqirFm @N38bw] ~;?CYϝ | 3$tήH(6ɴэtutyj:8fD?"B#mؚ%59Z42ۍQG 1QhE [ys:yMh$a #p~O\ v03t:38ԃDŽ{^x>:U&'NOZ$}MUҵF&i&us: Iq/, UKW8-$])jLƹ6)D$ny{j&^V78Ќ#|%G,Zg2VexKdV~`"bs(UfsAhY,b_㕱#,aIL!u7܎42lȓYHޱ ^v$I3 ~KI%Q{ 4ܿld8y,s@GIV+5Kڏ5 tYG}*dEqN?T*ߎU2eg1ger:<82gu˜g{1C%8ЃkN}V*2gq#Hd9.Yb cNy:N^z}:T9 G{Ҟ$%Gp.^pDa Sǘ~p#8l?peatjAdhaHQ;e"\2v 6[Я3g"[=U@ϸ$Ɨ4# B`)Ф]:Iz-тʿӒ:GaLӀ^gP?;1bnMܛLfTCM4Mt3l4\F`G@ݽ{f)9Lh{% [G[n 4F: 2z[= *-kjZAi?fAU?^ifV>Tmq3S% ]t:|p3!ah w<34&1!?P|*;ٟ`bX:g'fĠo4ROj,"0S3 ^n4Z{Yt`굠G| _Σh9WkY19\9}r@a S[4hw 4=WkkBU`!\K,¡H~~5qrٽ'paOl+@6s=#rM%Dip^%4-G}^Gma("NM!?3|JTlXO ⢓b|1?uA aE޳VBH櫰S: LfU44x6^wi5~ݡ6 W&tjHȱPGbf<>21w-,@dЅ3@&m@odT]ܯ^R9^Wv%^|kB2kMJo?#?Tگ [dj %m:Qb U F ~W@PtYP8+@1ھ>.Ч6A{OC9L8 :2oU>0uZ+ktPFF#mXw/QE"QB|>w(+~|CvRd4r/0NK4 x96sTIbذPer}Ps/-]~!*$Ӑ]zZ2fvTjKv"6mqG3F4N) 5T(@7 mJ Ҭ<: 50br_t?j>bIC]ZUs5 4̟M |Ia()z4́6AfK*Љ^vqGT1T/ E hX;bܺX-f _|hN4^.=ۊ޹CtIPMd٫gJg{]Z*є_@JT?jã&[ۻLh>8lG,3hw" Uc'OQ:~R,n`<ʯE(IU!Wd$LZ(rxUwdxLN;\م$Wuo@]};]-.`ӾKeN. to`2oVշ=n}]%}6u(w3Sg ,8ie|ϟ8s()ܠ~̹K5~u8}?T`_*W/ů>4e4[?4B] L"#~41r㠡܂?G-~!S:ޚs׈"imXeIJwK"1#F[WyL> Ӕ>4tX.|XdFnQco藶%BBˡ`=ٻ#GQ˘F&I B߲zY{*U r _B GRF;>H5=L♐}[YUSF5vW􋳟#pSBI?3PO6<NGɗ-QƯhdlx8 4ͭR_nܴjUV}ad67I{j޶sρc59uﹶ=אw{YD-^N᧤9+s_E 萀a̜tzo:S"Vky١/߫ I4le5X#%ˎcs{ٵ{5Xk_]׶R߻];dcgo"5WQb2:dL×q.|uqy`kmkn:& {&6 ptQkVpMwoMȺ48W0Y+pqesTmXFo6Qz(/x3$~ԍ}Օc J,sErӍ E\@91Z܎XH^vaݓhUKpWӑ\taj%_/ͷYGa+8!M))43MtgDRo8CHF]֡-8rۉ=TUӯzVʥOu/p^*׫@C s9[4c$<9]]~ `0*A>]cBg@bg4P0w{.i?#151OxD(gi!#YKlS{9|ED"<,#!By!\e̾UHQ c,ҨG_fxLRFni>p>:Ta ?^|8*`F+ULk <aNӹxņ23)_lMYVDx4E-9L+ǚ4r'۷fS޲Lj Gr4suHbz*zWd"G,l&mzN mAlF /m]ftڴ ȊH4ʕӅD'N% M肩;j40gRޟ84}ɜul7r,fWcd{_=Kz8QqA̺lī!a%iZHz+M˹X ΐ`̙.WқF I?,Z`Tb(=qdGÄXGK|Bk5|mN2Gclӗa)EWSNMGpT_ːpykWzk}o_ *[wRF~k~Ndt6yX> xҞ/m}hc:|} oC?FG ?ݷKI Hk]朶ІT\ѫ#d't%IEtP*e/*iV>yi=vKmhzUyf(6BMNk§Yc~j5wD|[U*a %(5Gg(nU~[݇6kY>^% xJ1V[B<;%vjv<; !?1<`~_` 9u*Ga(M~*]n1 bDw뱽y!{ slB|a40&3Yzބ9Jgh0g?;,Â8٧P3pezYu뢸 Ӎ/ljq肺;K,-&e=N%씕r'\~B6‡2=Zns\WaL ;+|z6_~' J(r+a`Dhj%tc{TI7 ;~NSPz85XhP&dם׽tșs5_ΕFw2R$8$LZ|Bܾ{NrL_]IkS8B2 cvvذ2lĦM.q&o>M>1''9ħ|Cs8 *!$IM'G@"Oߧ* m'ġv"i'm`y8պ<{Xu8 'ٹ~r]_ЬOatEokF ˝۾&:ω\N7߃l!S vc9.tzCk:>JD hLJo-2?G8w3m7ġ?w.'O`QD?^rbyg׎rH $9Q G(h;gQ>P4ZUm_'{6-{hbG9'6gS%0a辝c ^8x87m8U]X#1C3(:` D]ّ8" xNHPs'Gb'$͡~#ABzgZtI*K$דXssHvjdv{Tb1RP$:ד圏0aA& B+:ikzDjF);ٽd6]p]7e2eU-j + 6.<<S :}Tjʹ3Vu RjJ x* kG7h=c'aM*6JrdO 64\VTiDE;|N#v#B#0=ү]b6H4#0I|ha -~Gd g&=3}ƁT Zuf8*:*-L>v) .ľ`{S'L6D;qa!B,я=׷`z`+cie/ɜGR ө daϖPH[>G%_XvvuqT+8_ှ~Gy퇓@є>TXtDYOLoۂn&~.(%B #G]IެaQqk-4=:HF46Qڑs_/;%)ٮ NZX=lWs|GH)U3)SuU/GvUAu^=vUbk5]fr\*ApGrBʵfmU/vG00%c<j//ǒf%'꾿I֎tR#@$/z3~o)uYJtEwB*){⏥/yP>S/m!q/~ݛ5|۟-!G~*%|SgՈ;Y㙉{Rp:<<9tV)`ҨQNTWwUHJ Q }~F KO(Z)*ZUp\(7+JġҨE*+&=DuF-NHУOQ{-Zg:9:ԌWg'(%uF9WuFOQ{B5NҨ %VVa?FDT8ҨcU'>FM4jz4\Vg+ҨAJTX&U"Yiޣ4LJ#djL[i8U4bJ#4Qa=W]1VÒTF_VʨUy _Q@gQ2 N0YeTF2$T5g5<%"d*#?*#,zu:oG0:;C҅ $OKcwNܿD?1os2o{G?AۄⴎqZ{i}OeOs-NKi}9:=xZCcV>NklkCaklp5ҮxN}=#=|X(9pXyjwgu-wxijJxB81 5)[QqT_:i;o{~԰J:ų;#91Jﺇ50zǺuC_{X#@RDN9qXJ>j;uGqPa}-tX/8G9?0t?IXUhQ1o>=lpNΉ#~r֟8Q7=|Cga?DNPakxP5)?|3IL=)pT|8GR~3*>lkCKꇊ7 xalF99U(|+ڕÙ>T|W7kO*>sq^ocn<:Rrm3cDgSt Wmm]hChEn\;#:jՑJ쳆hgP_,gBcFClhLЈoZMC#kЈv ֫{ ԉP& 8:qYOdXv2ZQN2r"|sbR*h3̈A?̌N3~UQ珜#%EA8Up&W4e/5)t/: au](Uf=`f|Eiixp,˹ñfrjW?ViƿO6W;pi9X#NX3xahcz ^܌,%p H#'&]BKc;kOkN% )< r=- Az.宥H/܅`8wiƎ ^KHKޜ%- 줥ʋg3]R 䥁s4-4kÜ8kn,UY7w<]QIi+Yg=}|.%7Z Z0dҟNUKVXؿx7y w8cs':RO4y8*~H섛뽩%O3I!OnUQ_[8 !OeǑ8qR˜WJñXXgO] k=H K $X}1Jg {,EKCoa!M)|)TO`b -5 ĉČKX^ύ8a\G̼G.:) 뵔GuHx/ 2>b%lg0b рnE/%syL0:8dd]Q|?J>owՈ;Y!~9眅lx(]?9㰯W$^qM3#r3싃܃DcB@X>^̄Lg{܃܃܃܃8'׶5rӟ]!^d0Rgq8YUS_S} !=038=䉹)*seC8~0̦a A 5kS)gdRApژ]>xȠr9?/X#a86ը!}rjV:G9 %|[5pB9vYкޓ^us2q>#۽x"0'}TYu~̿'PˎB:^ztfË9q5NuwJ ^Wz1\h)=^qˁp+=pĂHگq~tiYb3X![Nh;byZCd\Pv{A\@F_FzC,蒂sC,0!:gDh%DU7)#i`%NK,V pv%6skx"!1Ų &r/^I9aw^_DA`oꌽ.[le=b9~:}V}ln|nw %_R' zqحG\/L665Nú{)8 ė?SĝJL99u3b#,%&!&BaB_t zhLSYIo%YD§fH KWtU8%D)ob:L!uД1j'W\E!JЉT8R:0֌8^WB"jEeUdۭ}u$Lé9LC/Ǔ*ۢ{hs^?pS^tpH !Gqs !ҮyV[cP,rPl)OnzcP _sHj'Ŵ̑Y*p#'e0zB1zT*2PWHyt.A?? cy,LtKZ8yiZF@M.1B^R^=.tFg8$SѴY|Fc= Giʸͼs OW]>E2=SF.Tq0#'4<{fBR{B#n\.kЗ y?3_V>рt:ϭ84ЃqA9Q<1qfq:=A 9X8w/9Kt%S<V|}koV3я<ƗN!׎2n>1bbVlKKV;/B„l>&MDH}nX$p'WZ8ԶaLkwJ|Ʊ^{6EVD? srV^8w٫TƔOd'K}Pz/y|H}g&\\^7%Rg&tfNS*4taZ .+j:_i]f5߭n%_HqfVU5t Umbݻ=*Qyj(핮V:weݭAs3sˉ}+îu^?ı|[zܭ!mdOV{JTžnXZn>ku^W}*|87?@I+w:v|Z]^vI׫^^9^Tr«כΟ8zJ$.<N<~cŁ?<~Ï5yt {λ a~od󝦗8sy[!c}ۇ;絢_yd^>l؈z^veˇ]/-e~} `vbˇ퓺i9X'LICXtʬ{8 : Dm$.I0" q?/>FNw(=a i2D/d!R$݃G]rcYCAjBw) BȨE0"yHmCQ<_z:ݝV4Vv?#d&7-8gί4dNgW4v@>"s%EȯmHqj2F:TٹAȉ`mp~LFj` ș m~BhrpO}&mCT_Y5/U,Űt.ϔZcZ*O ";}E8g_ɧKf/q dj=4%?y>D?[Y~Ʋ10{烤WLĸb=ñlYB+S+C;b_z؆}>b+!s?}ޒJ4G%arGq\ox?6p܇Yuzx)ɒ?$y Cɯ8%\mqd6W$+!mW+FP /bP؇*lC])IDAK߈:rC8Z@mkW싙b9u2$Z~\ FFgx(5"`LÅF`*B4iԍϼ:}%F❽-V ;$PnOdNv5CQQuȏuLWay8&o.Vߒ Mx.L^<^!{z't*@lցa` f1r{nCU_$AїКSGQ@ъΆ}?82|s@@~S^QT vw0m[SAU`H_8j̣lZUJ T(΁f inD!g`Qar~UpgU/%CR':`9韼R㢤4̭\jEڢt0h9%a] -8#Jd*2ZHKk)k~D+̲`8$IyO j>t>-q:?7Cw D8a?i)ސ \YkC&vy(5ELf(!3mp^jD0}VFdGԆ9%(#M 0jVmO ??Ig꪿l.ɲ%_CUHfҪaꞁ øDNT'}d z~)rx~`<{%tYpW],YRڏu>KK {}9C ABlks xrXJĩDblllSi;NU!/q#7ͦLW JnH-=4 ҋg[X تA jſ IQwp)o~_+`̀f) isTgmKV"ګޙ nmAxe!%#w;Nj0Ϗ[*u/h_ZzHn*,пb,Z;e+F M_cp /#'ZuVq5ɷRmqY\ّ ]dŢ '(i פ ̻q)B)X6<Ϙ^ڴ i ~S0pa : {>`&bᬭ> Is±";RC*`ݱUou2/*/X̬Cִ̀i+uʝ}#ӳlcz?q{,_ˍV9C5Î9^7j :@3Rtlv ~rj5o>+?45vCy*mOsj'rzԐ]QU`*O5nVSMѵxL,'Ajb&=_/$aUuiX634]Ep/EtwR3{[=vUyak@S UOi_P~\\ [wڢ!&H>؀bs *x-ьsm9vlLo qlx}Hhȥ%4{-(K>؀({k&:4d%#m{i@iKH[/H({ŨőH[H[9x:X#m4ip#7<ߪh#mUw -pG~ՄwG2m|8(ӆ񿣛3'4$Ir^R{3m9cb*Z4iAL@PKO/{7khZ\Úksm~XCr`drH{[`KlB`C~s`۪c[b!}aa _55D;XzΞב/[M&Ypl|+vS<b* /Vp &ںy|ǡ/j lOEo"Y?얢 P] vr0m rOጃH#Vt+XLFr`{iY|op(Cڌm, ^t~-ӆ45]> wC?/I˿£r7t7SNma}< }v#%z]tixBwxԀ/EoIUsqb}O**`;DXn[N#mR#ˈnlh7kzxwZ27>P7g6+G᜜SaxnkP~PΪL5k# ]ꯑc}!.xM M$ɾ?KՔܾ=;|gW h^vQ ?n68t…k}am+lwOm|i0P3er7xJ}CA}vOZ.A5Wʿ[(t903:zg;F$?#}Z\|Ml)j?NL%a;&'"0OA\\84DjlFd#õMʞ0v#毨u{*5qYB6UUkh AZ8D ؀T+ٲшhn{9;>JlqP}CV~Np-+Psr3~$5]C cVs] 4 98=}r(zB&h*8jAK[Б_:=~kd}QuIO6sZ*a/ G/^?Oǩ8YiS(8KQ}&<儢v{4Y.mucЕ /ұ#5*|ɶ)['E;VuW׌?r UZqv%Ozrux;kQ_N+}r>v`g.q?G7^R_N8WgPjRy/szqBPcOR/|L^"C G3k#gbM1&a pAd oq 0F̛rl5! _ 0p9G{<8@bvlk]̒#kcMY{{uOcWUf2N=rSï<24Ad*،D6ó{'3*?|+I+VXtGjqFS$*2$B˅QAG˚)7&wuKio/yP/ь0=m*`{OF\$PZ Hu0#;#`Z; W#V_JhpB E4pIhpV%[^t;_CO<:Dי RF+kXvLxOhZHzzD)u;Aꨣ1I[`TE.CdwN԰-AMq^tiRMEA pQ$}X==^A\zW 'MhK|\EF Cn$;_:PE+b01f#fHIY NIFs*ȒN}bUbX~KUSͯK$.p-~|ICWO*X½A]d|e m}:dNڬp.I1aSrKv&XoXuF> *vbJ[iٖ@L8MxЂ+b,KH}Ao^T"q+~ݕmA+;a4/NZmcb0ִ~iyYnF*+hϯekNH/3O[{UfFYH l-ˉBpP^5 W]/VI) ICh{aI&V9+d| -/F#n\a +@X7B0ʼq~ 3+-yyW:vġv,NrF)7 OЋl!2'} C\g'DkHZgi/>t#;-:P3hCmܸ<2Jq>2Jm;y?rnveRkJ*ii/GvZ}^.EU|$bB ژJ#8;{r"E8DhKGX˱Yl\kܝNއ*EhU JL~}d"|*Ոt<LjMJ?-0cY#]&Z c٥ñ,sXR#T#X-d/שۉX^Z%M,aH,|Sb)M.'XLTlth_e#xpC?G^)pJ+űJy8D8fxȯ,+)+i4[7-BɹH+Ź,0RZ)RN+a&.MEMiK}͟ YTn.ݽ@or=1k"Zv#liy@2’>KږQVIRzLȺFf Ē88DMuh0o+b)*f3 A_Z ֕Jss #[{]QGlMrYش06nESb|a#$F~NOQm{9iȀd≓'{[S.~N)>ZS~@Nqt;@N/[rCOŭ"[b8~eh_%n%8ŁS-bȯ8G<) }K̀r+OQIFǡu<07%'8tҹT ۊXąs!ΦC,qL'_tͷ=qk;[[i#5NOEGw8ON>q ۆ r+ чG#'ɮև'+q:p!=X1]s 8ٛt xH~1 Ed9I 5ٲwh W?i'{:sɈ8W~wHdnጎ H8C瘽chvq;t%v;}كqK8LNלĔ.aC8D0Ned:! so5o8pU '8[Q@FqXaGVaF@8uiz#wa;HZFD'.qWQSNNqGaM5tT<;eW) R9$xLy9>L_ġmPcPDpŒcmy^g:# mS+Hhx V7:ts>z};pP&F%-(A'R ϺډټQ$v1vto@;<#C&X&]N /IAoh4JW(Tg6">MPgh(M~6#2`\KVRRZXhMRRfZjˑW_ |ZH_ H}h#6vF4T󁴾&덥@YZdaL^N#'흮.SGFGICwUhБkZ.29JL9tq%1zP[P"6>$-dR+s4m} z{-@q]F^NeX_u v;t>3NGNHT7G1Qxne 9 8=zH%\!:}#e |}H(&"ǘRb#0&qFØØؑ`CG#r_/6Z%־QLˑlrz@G!yM'Y1mߚ؊ulhd̽ib[b=wʅ7[fh9: hUG–d£*71=26 ch?7O;Ҏqc,[XEw1ʼWg.ܲ5u( ֙&,{¬_8),rN0tTYp;P^6̈́Mb Q&E0;c#iY.HF1ʲE.HїHyE)m@aO- KŞxç\qZVƽ7i{YZhDkME4=L=% GIsԊ0٪ 枉Zy(U3drp>u0^v.ȭClE=¿?NOUšo("{bjNt1F+|7 0I0'ZfSU{CU)'0,هEo} 51B`Io'k#4 sEBPC /hrUYbf6!3}l\Y$ĩHFsEA LY| J8S,)KA"ʪ|yU1=Sʜ@o4.M$m?:xEP̙Ze>JP3:bβ PߘtnhA<\rD EpC|PdeZnZh9VB~0r@q=sjٯW246RJaZX:%aL rOHm$B[s1-Wgyj!;RH\Yb,;KPXڳq8/]^yҜ*΄G M ]S]ppQVw .¡o5]oߎMWqˁ0̦`\%\WѺZԡІWӸ!StYsQ$lxmk ݣ!eqP`}ޱ өv33e h'WHV RF"&9_JZV`wd_y}t WoG~ ֚^ftt[@LkNj쵐7P~)iI7.3nrM; \=uC6f['JVrRǫlϒt:K1_X/`X~S:b*0 eEqBBTI91~YtmbRa%<6( (Zt%Yp`|^o8MĖS6婄b/4{GW4MˀåYۂLTwG^8sCCJ(]"U50L]]]u47y,-sx,ON*K½Vy [S4%_}S@n#NKciH ix8%~n D ZY@MF0 hZ?٫d0NVYAQOF=8F4}^;߮q*S <`r2e{졌& 3>yL҅p8@| c@ъO>R󋴋ż47DU>rֲ5 V^Hs-6j&4GԲ;GJCtS"F"cuьV~f}> }q0|h2Oug3Rfl/XV7>DJx ~%A~!:*鱪S7c=zW[Ȱoߖ , L]\9x(yyqH"`ar~A0Us NtC-/>5-e,u\+a("@RwU])RE&k|TLGt+ iE3eŗƣ3iiGLb=4(f!IZxiH{T`j#-!GR)ZJ;R>+, V[QHSXK W+KehPk2Wb-}΂y40xq@YI@Cl!,~??3kf>ҸidKG^b ĶA@}hoSqw"8ژSGf;9k~wNB[g6O| 6OTqwM\kt F͊+q]DŽ.kZWU'}NTq[-|kωeWblg62QL<-+!˹ ISc??-}͏aNEb T;]>HVrw]pL}CKh =m 5?8M;hHosp|HM8X0et#7Ǽ IanX/>_N#1 tͺ;@/vj1( f؍LKw? 8#UМ,Zt0T>cMU`bvF86a8΄hRxm# OWYDwޚfxgWZejBHnQ/C`q8ʗ]zI 32 wvΑFWaf4 vr̯6~fT8&L#踠e $Tjb6G۠< Kry Ǫ$&M0[{+ebzWU6k \!~cV1d梤K[9eE_$Uؐ9ht]V{b.QC&˶lfXn cz|wGBO<itk-QX$檝>Yf3]' N~MZ0Nk&:IL뛸a9 c|[.Mey>{|ɼMf',s1)Tus~mbeN1nէ'Y>8E>d{@6 1hiPzi8PybINu/ įr)56(Pz=p{CT+lrCkY0 ;Γ]2C "L궙N ~t=|+{WhmJaIBV{mw=/Y}h'Rl'dx.GDqb%Z Qae+8I$7tcճoA&1ǎ_{1}I jlZQN(JT:‡$װ9E42K.'b*2_9AIDq Iٍk1 A}AI!7੽n9& tW^Knkލ!&YO'~P-mR)ߐcc΁ 1CXd<WcHxO%^%>8_xT(1i#h%+~ r}{lD-q9VkYwn8Jq]q8ti<'O#9yVCL:Ɂ''$OpHo#ptȡtux5{Nv, Tv-lz!v; DZ mؔŎ19ӱs BV 7AȍQ?jx}ڀL6)QN}-H% Iņ0Mp%Hqyg`V_߭#O+2xZiӏsȎuSpZJJnQ9>r_9*%L&sP\'y+<'^jiE^lN?&BEuX1j=u` \(UW8{ùxbP P6l*˸Jv/'=ğ8=OA g { {@q%@G~}}D!a{hO~VkMv#nJ[=5(r{ò{C{`?a/8=8-?yVs@s9& Z` J[M!9@X\#ѲvlȖbƧD60ښ6F,!ԞWz|N<y(sv*c߹ӌV Q=q,2 PT+]U@D:t`I t |+~=4^@hܣVM?^1{~ m"ѿ3hB۝^V~\Fbe# sL^cu9shJZK6Y#:Pi KИg>5#gt)@ ͣ c { .@p#K`FA01A-TP zcd.(̠p>@U0 =`EʰM`؍qbPtY 3e80Ʃ0f%`ɤGHQ>*CsڪEBeخ"sg9(BȀ@ì:Oފ3"T(%\<> 2\:e.G2}=a<52'#xۭا.d X7fN {k6>z/H̠EOFp#b>R. Z)Ut<)R۠H3.DBoɿ[}dKNΜ2Sό_E o|4&mxh&=>t4“γ `'Oaԛ(*mMs^ GӡhJ M>XGF{0 /RDa+O|dHdJcϓ\;d9<7=zw䓉v=Еs9ks ^STFk91J:)ӯxM _=ZM‡&~}Ʉq/^Jh}4}q<ϣq4%/z\ds L}2!94Cɋ1-MXkfXhc#!sp>.~]%:Ō"i#we]Tz*wE. Y8AX"ԬxoƙJL+r@#~}8{XTl&$@3G7Bk2vޱ/ Dp(rH_i.JFq= AXrJ`:R;RXe>`+P&Zq ~alA qO@ @k@8JH^ٗ#lMu5;y e%%9e-:'ݲ Pple7}r=KhH#M!Z,["},lT8HNˠqt+mb}&oR? g\[")7A>l@vW{ Cɡãr}>`S>[6y3 eVgnheÅ N7|nHåK8r>_[eF/L9%Ĵw{gU[G,Ykyv4hl0m/Ψ=x<[I}Q! "IMb}6x w,[ 'B3hEX£EXF- qh8oKMGMMb|7p[t\9j/:X|"U??"tuL N:f'&M N864 0Pyݗ4k9Q#S+}FX"СFH Q$ s뤋a)Q#`9̺n7 'TK9qiv)' .p)SޟlGy8U|fHɎ-s&$C0jݹ`=#9V}|apmZ>#'@ շ8+ x﹒J_g0)˹(xVm?EX{YsC±ٔl: pW-Gx,>$ ()'fsdvQkK%0ZW)jyp >mЎ_t09\H*8>DBX])xua m->s"!dU"ŽN8 )f'3h\IjЩC,r$a>X#' $9P$!h$gǥl OL2TwO$a 2'gwhIJ|R;?^v(WnY)2;b_G@?qWg2F`W~t MLGK>yq0{c#?r2ffӁQ lshL e(Jb|ʣ]᥶8(ognAl'9+)K%&UY {1yZpH#\A?~/~cG @oegx?hOХ~@.巊3ۧr)?K]PX¥Qp)Py7ʥEr= +eD-_<Ơ3I2e6c _Qes&,ѯKvܹІU`r&\6&.^9fgC68>rQN<_Xn*kGg-s١)>]f30_F:S¾ԧ>84k]/tRΡ!`ثnp)IK%rd/l;^K.ʯ) E1Vn2kf{럟wRv`A&9}P10К9213tK_2h<4$b8>OFrC1~SbHٜ)Dt^ ؍3'*PATBx)z?iLs ‹/"*`LS*U9 Y.h.W=4 vxz|BxeZ0.Vp۱=ʼ )״?Y IUۄ&=hv׼1mDCB剩^K$ nⵅSݴS%N^AP`hKZ=JbH  9^4aJTь3e"T`g.-^qc^,J%gv g:^8M$M$%ӕ/V"8VmZ@ejmt2 Wfӻ=3Y#X1xBmLs }Dv? vp0=>뤳6gO-jhc q|1)Q9.t=,W<0. =Na1Y| v۝+N Q{o<>S>3!Vg~NiĬ#}4o1^ ij?1|I,t~K&8C ^]'}S6?#N!a~aYu:=b^:r/p^Ѷjԣ?1bjx_*<7xC͵f}4m^/g S .-iRS>G\Tzx.wh=_Qmr ӄ;41ۉˡf3> d[C&9@o4Ο3R٢Aѧ/!SGuq+19]FH5}ފUzDOoȀC'ЗsM]mU-12e2t :>#u/y[Xx3fg6QDu+m49Z,>#oP Wj{6\ c"ݙt:A2n-,9 \I"ELѳ~Xq }>b K\ Xvg`<0>E`X!y栯xb7Σs9Ԣ+_U`0>!( 1rOo{P0]l8TU*(u[-jn#,0*~`uH?0J ctr"m^Uƴ;jk3WI-,b?,>ѪE<70UsQdj۩B*Ҕc;էdȱAcÚ5Qܪ8J>QY  `bu֭yh{WzGDa5[2E1m~)Q7o+o,f#}k7̼#E,He09~G<5EݕkA75&ak1oZpa}P|Ua5R :/kCkEp1]*^-aȧq(ɞ`WRZwj_]x%cg5NɛcYvMs8bfIc8Nj_ҥ>{ l2a,p+0`q3o\u\IFX Vौ!{$`S_ T$aed[(SGRx|qh\ؚ{0d4@C>7DA*zcA?I< >UmMPOejj 㳖/ Ԝ9:)b|J`!bGȻvo6sG٣Uamݢ%`7K%.-yD0~!̣,crGU>(`6/h>bFqڒقAcÍx hQ3e Y d{*L,w_ﺪ<,>R2u[z=k<]CߎU> }%MfSg;DG_BCKs5_*bӎLW2X}Piwk^aL ] G_)Ӫw]ACܥbGJYu6yr3z:Q _:w!68|v.ǻ)0X, a>wa ,jZcm6ٹ8uoК[\btc3 v]vuq _)88ř`t [tYi͹]ph bc0:su:| =W>W,s˭jhsw6|^`|w <Ź<1_[s5|qn3rnD۳9nOw0q{}{E>ľ>CSR7CEA%1L%햀Ta53j<|=;x<ߋ͎[O!Uf 2rgP@hKa G83lEu]gC$ǿ͎QԂ% f>m$E[a,C=!L.0DV42]7c+L ?)]'tyf%}%BsEYE`aj Xˌq #Lg2]rżeXc^:^ XؖKW32H]GZ %`ݖ\n%1 %~CK~҃,%0ש3Q<1Ҕ31, /6O˟kx1*x> +%{U%6ծ1^:0^^sgS/i8/9ռj^`3|G{HXPN`'=c82ԑamnY.jt u7T/tbR(\J܌\]ol ^EʞlߩAh&YYL_[dޖ_Qahj# !PkfTe'4 "?(5Q|. c-2b'.}a?)%vxc:wr4R:OVT(L7{OGnxT+~ I-=K0<2<]*09iRꝱ@"NVEUaŰX$R^bOl*U.9iPY粇T_buV[b˪qf_ arhb,fXK1mT 8h="75PP[L 0|"5\-YH]gLVMZ:$B[Mv;C daeV9) Gsb R;uQj"EFCiQ)!/ !rMTnQ]*Piś(uѭ{i,5lc[]!jبW݀NP+B bܿ~d|ܮ3cﷻm  AacvQMEYugȓ^S<Ĭj];.TA{sJt+|̚q}Tp JSkakA! ,VS/@r>|+&=8 >>k<#J?s8'ȥ'vU6KWnJvSVi^K~-.Cza8%GD_h ߫F٬iQA^$ۤ"ءX~_,æy% pulbi&±I JޭD{jը. AA>yЄKVTnsęN0K v/egn5^`<Un]c,tEg hhڲTN.CѣTU:v%~5ӭ߻Iǯ=3semKuVڧÔ&gP`)zZ%X}޽nn Xc^:^bD Dw6 G\x?F5K}/96Fg.وF{aj87L|UO&O SX],pwV\ [ۗ pP8 <҄}@q }@U܍>Jj8~B`=9jb-J~iHe 骲ܽV~s7H(Wߋ k~u&tc΍/X]un \&emlѬK5w vtRT_7xZt}ںurG#].F8_}';#ݜʣɆV8y8pʹ]b׹8Cw=_7g*od6ss>7'0qs\cpnPpuܜx}s}Al%XgU*` slZW@k:Ռ-N6yNګ4ʼn/,3TT塚+Sʸ \1'QrExuyZ݃ !ZC|ğ9۫+cVMct{\Q'k>[{^۫k<(²Sl1w߃< T>ꌂNYg:3Ӣ6VPnb5^VUյ1ۇ+-ceJbeOpZJ_rQح Zگ+a׵ Z.ǰ{Y<Gԙ(y>ŭHpbٷ_ɯe$+.C, >۟0_{v% }o}:dv+,[Vdb̟-Q .K]t  +hg׆gسk9l1@eu{ݠ&}Y$߻*zr *BQ5_2<#)#83mLf&:m6ҡ& W+@{&3Lqߌ nĹ8syg C |:(+aqǤ˄32Ǥs'Ztg1iF5;Qf ׏W^vRo۠"!̦ ʌ=mڶ0 ul#e. a‹fDUkjzH3ғPgҌ,bPfYeP!efi~(3p)3a?uˡ]3]0mʌ_3f820Q9ߛ6o 65Wb#qȷ]vhMbf74qKlGӪo߿P17kȁ# ubG.YuRV{"V!湌P: Fս-MU}܂_pFڧQjO)tZirOi)1)%|mN_}SaSA%RD$kڣڗV;DP"kV`>5sD)1[sXN2^ϒ;) }9uIYa2;6}h+XT;) r'N8 c]R+O=~Qۙ_bMHo';)pyAr gQN9ZiZ(&@gNtv(͈/4 Iad`6\;uWitqBG̥b]N*TVD0X>ρ%Iؼ;lE3͡Nz~: ;+?)OqJNZ"̭kqh&oZZAa0  'b_n_T?b(OdaY,;Aw2J(k^قٮ(!ḟ#UPgiZyx&TEc0 żn?HYX^uΩE˛~`\*gPr-^3w#H[vY~ic*cG 㶾dUݴ!b.L!ZޟJ_=lZUy׻8t1^^ .'c4n1cݲ^^DT :*0oq2k M^.QpsؠdE.yOUݬz[ l|qLk[BZ ={>bVxox+7 o^[TyY1ʌᮈܸU'Jq}‡W-Vys O(YcjǸߣviCn"CYB=0xoxk75x M?wuR~9ʑ ;`YMw| TQy BAW^/K2U_Yi".G[Qm?R}J9ŴھXSلŲ/tX5w=]4mb)\X/P"}}0dBRqH'|{F^{usnVbͪbM=kVkL+]WK.g)W v.IJZ- ŵ NKӵӥn-YݡJ37> w4~65Kp %6\_@/XBC8{ԥH p쩝iT^ۿLjy6%~̨? v-ct 99D}I3 :M!@%R%,n'YT^u8KJL:/VB vrjKٳrPVP#`dF|kn}?ډ{=x{ .ɽ<ޙQU#7ϸg[젅 -.;^>^(9@RŹ䗰}\٦׮N7Q1m߿%.ճۍ9vE۲DܬmK9 T UTج-hzk't`4 2Ti W .zȇta'39!1I"ܘ%HcP6@ȒH_Q7w!/o8Y`5:8ZtDݳۆ>:i мyj_ ZXNt-{1aZ _`X LYaSZ u빫EM/_$(Y* !+)Mc' su1 a 'LEe ΚAcJf}s4BU><5/w=%!~1 Ú5t`#Mxh*͡dcEVcgG{~L`e />ꂜx ޗC`N4g /sըQu 7#H 0m1K\-6T\+"Nף8ؘ>7i=J#̀y\pM'o^>"kNaL e]-9/~0O:w^K_XuE0(0X^QCjNGWr7HAdXex1/; uOib/CcizshR~lO!mxH kEm?7CYՃnJV`xBePt_n-1IY!sLQ8p8:tYŻ˗VeEG Pcyw$%U W\ r`mAo-b ,m)lEF!ɘt\2?aηWb5cs!(l,"]U=BUӀ\Ӎ{%uM(/Ib oFf3* 4a1;7|_QxoI17.*[\|Zyܸ-:s\vV '95 s6o?~ LI|ndN%Jn:jYd[_uⷋab?޸4ZyxWƛ~[ޡ?`"ْ v!kKXUGƒU|b1M|\+)I5UQxp-mk3$Zԝ% 75Kdpʖ,Տdn,Y-3AӰMi£YzXQ\>bo L,UhTrd lmYf#S$1)],4[XLl=mb[L˻]-[(_.(f1HuȔE 3[>}R ✷(Z~^1S*5~[ C$C4EO>ANʖ`VMCج`ܭ{Dg`i 1(/}[zLATq.L'iZ  ֭;LPu0<*bA^ӥ7fЃju4O7 M(%Le2 ߧAGB6Ouezt4jeO7,~XbBZHZ }$=eRjbY/;RF}s҈ZkvGS9eJ1Ca5ÌiuLFVꋨ,{̎0MOCJ/y^_,yngO /H{_Z|hXC~qjq VX^l .֤u ccR3Ksb]ti{G 3`L40f)= 3":Vz)KNL`WbBIZ2+ s~_=~&޽f8LAR`N1{~_410if= u>ړL` y ~ܿP9a] f. kFۼ]TZ~nUG(j{G8Y"Gc"Og@96F/pTYG{!`wE% /yZ3(4ijmý036Jq0Ʊdlz86P˃$r> DZ5[̂sTo>$! /8P[TL]"-,wn>M0z'ap! '}lq[6O%(!2 g^0sϤUC\$y+80ЏsB:pCcyH_]ajF7؎RUCGܕr;GM3 DY"b][dg!I ?;9E'ig-r£埥HjK-=\BaͫG Jy{p[>.Т͖5@lL.Ḭeh1}ĺʖ>C˖VN)(*eW pyc# 1gNTtfJe?%sVRy3Ou,ѷp̚0o fgf?cg,b]^ur>HW2 ӿvǬrGG>L?`@"TIlc&Mـ2Tր)WPpZ$Q5(0-<*!.5tǒv72W(dvS>4˅-J0Eg}Ǜ~ci W6,%RwmqX$Q@6̀WJ Ɯʼn_vԐ9b?:FߙB̈́5}_̞EbfݦbvW`{sddKQXZ+[1j?^Uו%/1d7b+(Qcimi=SD3,ԗ׫:E!e^ 5ɖI'O&˵^_2&tOKckN[zDŒn&8և/n̚Gq#S GzD `>oxK9ׂ9~@ (:bT=:4AMLo6&!X[tlѱ7ɎHR3[ꁎ1\t3`lA^m j0}d́XD,4f|H5[^X]T0ʍL(" #?* JKXP? # @H~7C]0*I xw] *0t' Ss 8_nQJݩE_ߋFVW5ɵROAK{{)g+[™49I0|r|G tf{ G`n^ rּxe{: a \YpR{;QRFp*#03xgMNCv$ }]c'G5$y˙c!a bi[smifԚ+{j-rz#xÆF0MϓKIBګ nP\e:t.R*t9JԽR R^ %ڟ-fa%aIJEOJ" W=wa0L܂~! B,LTG [HB -+~d)fEXՏ3:I1H1n) ,bK1A=R Fl Bb {n3 N2>BpF SbR̼R a0H;qݱ8^-G(0bIR J1Xlތ#"I1<sɧwcph9SFs̍2U6kiX$7ثuJgoNu|*vٔR-0_҃Q@)B:̢-P HJYF 8*2ZK]b5;K>R`a*="J wr[PD)TEr1H ^B <Q <N]T}@qQ ]R¿"4& bb7e@ѹS j덄0#D8zĜAĜW`$<;1qՄ "d;YN,!6L0|ځ_X@2pS UWf ‰W]l$udx mU׏q.rW]Fql'fұhqEh1D弬_7_ AQlk=bY|5~6ՉI_Mm(c^,%2ˎ-J@ެ8On _yl:'LKs˧gsR{3J-n0Kdq !3Wz3pe4c`7(€NpqF ->"7oE݆e(7\0|[p6: =Q}pF#!g0is`K<Va asiܘ7kPO+jl]-I0# :^ږ+UwLz 0N/saS܇c3nca~VEh܆[vJmgzqZ\@ʅ*S؝0+v Jx <]_ ^S pہwOjäa #O5=Eٜz"l>1`|ݘt0Fc>c1X~.}0``rt0>Xo+}0#9O@@dlL:i狘HA :*\Τ靎0 VdXrh#aU%GK;'W(c:KO-n>_Ke A> I/epi Eq{QL*,!ĭ38CqI/wP`oG@/R-4Xj,cש*OP;kNn mmvݘ!Vuk٧c;\qHcm, "VD 6U LНB%i!|1C뵥NѥdiOa&-saE|E?ҵc(`Zbog?ғp.}ٟ?|>.mgYQ A#,PEDZ1B5Q5<RE~a>dq9HLw)Osd&H\YRDGoqb iW"^ĩG\#jbD?YE5,#Ց,"Nd1ޏ!Ydm"E=dLdSǞHDzk\LdyV=7n`#70M~@E? k:UсYsɵtt3w%;:-G0W] gIVӂɮ`\;`ߝ #bE|mjxpqK<} 7Ʈ`qc+ \ˌka'hc+a|;><+ٰ`s|8 ^ɾ`a l?C+ZUNC>~e/0`/0j`)U=a~`:1n:fcP lcvՂ.Ҋ~jYh;Kd*} .n2.$ mj>M+QN1,KEP !}ze u?B!hjj  !<%cl* Fnqv㣞 fe'u{.QO+˅QuQ9`(mO-'i2ClEY\(VM(EYPQYh؊2N%թv@0`{eXP^vr za'Æ+lc@2UaRw'><7!PL6He\bcw$#퉪 ;Z&CӪdX*h}@&z}Xhc [<5N< W!e=Zi*^: q4RYx-Rx1mx ~/?sY6!b>\5g b)o[p֍5<>ôTNhl_8\E_pq%`yw\iۀ3 g T oqNӯ[X:~[8@ʾ_,{}ee0z+cAmĘڊ[ L; a5K8+!QɌs v9w2y#4<"K1~oş؞E<4Viۢ+bׂkK zL?2Õ"A|ɰ2(.zJ Ya*dۤf5pDDngzGKNwXsy'"3x)"˾ޅtblA_pň3gAAYz<-G6;kcX(Z⋩IplP/0V#8Jhc0J[.݉Ŀ ՋJ#4y7[0J&uɔ3;/m`sPS wvǩVv6b?ց99OU4}T o-OmN'L粟R&r+6(°U_opњY`٘n{e>nw'd ([`+g'V4VEkaUevJQQWJJN so )*ݢӬ4뾏2iwZh%Wz Q0:2`1wrSoA/^B<-x 8;]'CnOY'}|(ӵ W~]lcb& 0>E*bC| 8YT0]P\YzIUR 4uMm] Z)g!3 \],`ʭ|Nb_/0и-OA&=xFN %z};-"{O}ۆ?Zӥ7&s`?v(4(! MP#(fEV S*VE+Un0o:H=Ќ3ш<-^։6 #UFua _]˜8F>3O#O!LU702;%ߓ 3 Ab.)C릓F_aC^n<ўt&Hҗ[QCQyK`/X0U/yVujjIw2Mye}(S ] Oũui0˻T˃0Wd ':iɔwuWJɾ)l$j{Œ"4a h1 ^iU]-C-2^_*G6M3y!zAo'$Lꔚjpеyua%ȢSM8]Mi@< 1!2 /@>4$ .їE&K܇`;DU.->^gҚ,vYDtJXT9P^$sj/ ZT4 d4u ޔb)`o]y;zE&LL5,=]jXec&̤z&0{%<~aBŇQ5DS7Yv,]8|d)R9={'6*dpq;(o YT=9  r\|Ypd½_T*dX[q0@͎ <|>O'pt P>Je#F:Z431~ 3x䀑Ca*^xkC12{d=xPGg<>oXlZz&#Ǒ~0aؽkw 2GQ~G.z&=r\=I`EXa%0 0,Jv?7Q tYt@%%0S'$06D$ k:_a01iL~G8ַƙ#pag0,/[jUylD~ `ܣzo 0nLEzkyf_!%g%KB giM{IOHc KI1e_H'$ CJ&떾/-}qw"7znՆ>-Pewl鋥WKu=!}N\^FxZ̓1eca̩ϡx4x`y:L n_fـ> ^&Q\e_1Y1@?.L}5/ddq36"7" bl2հZH%H4v;K YU1!I([%g*:[7̕,JlQ/R^N =ۯ葼R ݾW᝙.:ک\qldM[Vì_;TN4jWO2Ϧrñ/Ѿhqz;}fcmQp/2ob-ܠF^穂]AғZ?u0LjRwTe05˺bo^j+Ņx]mCV_lXcXlƒ??58 pLo8ޠE0̓*rujW5_l (^`*1/)^te̊\3fX ܳU.^#zײ_^#r:tlQ,kD^*S{]d^o kϚk^3%⽮.Xo|s],5QIpOof*Y*vL\M?b~>L|QZ#ML¯uxOF=5& Z#n$zkWT~{Zl&_W/zN>ᱎE=<-?@ZY\/vgѭs|"?Xsu:sX*oXn#Gmg"NNOcmsX1hNX87SfC`{;\0#7XVj+ ۰q·Um5}€{ybM-.Ѯe˺c(`b&a}{@GLy{5 #`}q򝼲2_Iy6VwG_|ÜEYC v_,cEx1r g.`go/j^L0s[_az櫤1tc<ܭ2YB[}8 vfbc}`J\{xgiTOAWAk=*Xn&Ub*(8e\EfX`̀?EO% !Re-iJ-`rm)w]`}#,g*y L|a7/Ʊks d=M/͜/QW;͜~cX9įtVPzHE֛x6 7b^`{T~J\hzHaB|7 ͰpH0-z{񹍲J)cXQ|$p}fضPۺرЫh:er`a○6h>Һa 753IK+ԭ \q& i#>߭F̲bp/v C;S-/]|c;Z cՖACcZpɢ!Mn53C/!5j=I<@# <"T@0ӭu8QA&5p-@Dp%t pYIn 8Cu0+| Ő߼S9\JӅHa*嫯 V S)SRr9.UHq*P8V!~t[}.]:NKQ"ìT Ntp=BU*TNwe&y܁*|(v'.M]l݋H`xRH G /ÿpơ"u/H~Gfml7ak{Ez}>m Q{ |مX گهAZ_Lcl@d%r=_@WV'4y{CZ^^D>FKvhzYa bT)50WoW.k ]t=kʭ6Tf-#-a/Q}as' j;P%_~u1a;nI}+L\dr8Pi1^@_dr~gKj( iiK ntVRyIj`?p*Z,Jv{ h`QϡZ=n)>^tp hnG?_?.\›M AV#IS_[!8>+@rvvD:/.=κUe P`} ~qB&_ K^fEde A^e׆-Vc/Pt6-ԯF>0n֎!"wno™0q8m.qmh($"b׳-"`>Y= 󣄕Tpal]5 scl\mD<LO91_fNL̉p i^l:mG+6u&S?Թ4\1wôt2l4UNfnjϓ.2D ù͋NԊY[N z)jlaclX.bu)`1q(gqD+L3 I̢ڦ%MԹ1ԉИ]߄w Dx ؎+iJ‹ExQv$:m{^r u y^ ‹yDVQz/*^2l»FLxAxc'&؄wc6Eodo^Vj͒Ce~"wXf / 'cX3>`]=<k}K1-6(5l\IO\KBnXp}ܐ4 "uf^NyK15Fm?݉@>~@6pxk0\ (5a(5ϑED \ e 1jۼqUe[:s%ۉJrL cEq`b ($k4K" wDVOLV;]AdȰ`$2m b$A1rqY<-x޾wKG ,2GҡK3_'༏Œ\.f,iAVKkM烅VȀ9wnrMZWʀs:&^~rۧ(`oԇQ8偫k ̨9o؆XFp69W|^-8Fއ?J֍R 'E61<`.;af],ڂv:Uʴxwjmuem³c [r)\}d8CX-w:oҺE80"C%c^hҫ]LGpv‹qb\mky>J0&jSV |! ,ֈΫQ]3ZpH[ #AĞAoEC%ݜdBxZi%|o%XCGzcG!X nTDcF J{nKEsM!>vSPW/H4dS0$-g2Gy࠱#*!qS9;Y$:ZC#w4phh|ZHr+^YE~VY{nߢH}l~2}%0+KvGoe;͙% kt>tЯw9^([3SEm# < [H J>*YButan^7"~_G'pd R//p[Duż{8zujuvE=;@UQ.~A"/ׁov<X> ڳu\kh="]ބM%]RpX4݆ny"6F:uYw hGY,R-U N|`kc_ U+9KKp/2f֕>1_Εt~qp?m㏖t<,kc,wU\p.D'*}ׂũxZ^WŨ7uC,oŮ "ܵ?P.^AiVMΚ*RgY q[/O[JOnDY'0[Bx܈t-hu*kjAuAXB^J۱h J(1 .W99 %{)Jd/}qfrR*/>1c% z@օaYRZ_IK}BfkcDG%WÙ55"*#C2F9yڌcYLV3^/a=!|:ǟpw,0 xFp? CG|  î6qL{-]\ ?>m(0;('uxvnX)bCYů7|8IQVIGlp̕}Qܚoԁj=a`>PQ$(2FqVR@3 V"Fq~%xFi8HYjcO1ۆO !@5 TDw [u;o+GòrLQy/n HQc,:RΡ:$3GT:X˖v>﫡2Usb,4>yz¿@}Km,*>.wXNj?^pKTDaHbR`dSQF$*ʠpk"e>v/6{7n?AbK'D̬S, iI&WLpmQ@bkb Ϟd];|&\͆pƻU4)0>O`$6+"r90FJüRȳt ,dP;@˺Ӻ^B#3f^S"NiHnXx5P-Fr?1OjiA%/]sDl$ 8\BŊWTJUFr=ܯ'Frf:IX{/aǰݯ YYDFj!7O`m/$~nG|q@EZ 8| .h94OhۀY v)j#8JKP5st$G5Nt6&ay^r`/ c{r#3MRWt7:M8dEIG`kdhʄ&6-t% 2>6v8y$? 0\!ꫭZ\v+X^1 yIB1^~Z$`/5GZ6iQ"Oh{ vX@\,:BwǼr#5QJ(aR#*0Ԉ`+)5nx* \緆y ihyI\vԈYԗ D6KnRf56C @T ҍ>"z79J܌Pifh1_#F>YU>X,4&;1;|B#=ԀB#ŷݱ>P kq 9J̲F҆pkT0z:fQbXy-bƚr &y`@Fl]z`ġ8(zXrL\cT3Ja0g̔­0h8㧼=#z;H%{^|{}I>!,@fQɯ!h qf,40&u9x[Kq4N/aas#mϢ!Bmru"HN?+"!>v?N?p9}_P{ v,J >k5#<ycB5U%|{/:?kw yf&O٧,?`v]֮{`~$&pr2l$(alFKCۓج0wb*Z~狡$ n)oA:B1~ IE V"[gFLh ûpM'$m =\oXNI=0˰p0&1Ȯ'.N^yܶ~oRdl'In#Ipd nڂK_N Vr 0ֱ_9u鯒[BwGwyX<8}>z>(O8z<,W *^YE~VY{M&n(Pk9__1fjR6ox_{QnG3=QM\ym/>*G5P5s[oĹ!Θ}#R<%#GX(3}VX/kH}}7&)ԭ~3XV`ƣՔqEEj,7IroXJkOiîGj1>p т^Y /*@x|x:&;cN@~\ +|MB:saXgbɁ9Tu] †crv4T,JM`l:)O}bTg YQB4![ Ok]UujmAX3d<`~? 3v@$7#9f,^( {oZO->CZ]wS^e pBh XkԽ(u87ybJ7%Bv:iK B1Ԟfme^?ܽGE9*M`xTzdC&íC{9&H^Fq/{# r}CthC-eE orv("71iѧ6|0-FTr9*LɺS_2Km}tGd}//7ۘ(2~oɳ.MQ]u[>/vPz0[q0+Q>R]8SfE`ަ#Tyx}(TVE~^?_ ]Uq_ӔBܙ}E&abUhN9 >w}G⡄$T0mf8-nYAɩgV,!!`hxЯຘ=މZ»b rT5:i9ZW?㔪oJp,ջe6 9.I)'ݜ[oLXz$! 8 Ǖyv٩Lf7X@TWiz6ŒN;L"=ID&qÛIL28L"hG<"8cG<9]"xDT/F)1R%~bb.qc6uDT]:3q<+qZEU:d.cAK7\"-㰉裗&b2HJ,ejø[t% >+Kܟ&⮔fejib/4jx8nz4Ʃ/\RE_B3`8J.jc%İOB{TX՜T1ၟ4A =b›3_2yWsE0:6ŹTi7WG9Աl eH|=j@^ĕdw|x>=)3{1,.̥۸] jDS/[h*a9/n?/]un?ė틃9ԕ-\oJY$M1Z|*y[W!"5ޭ@,f/8 p}),CESVݢU#?X}*w>χ1[o* __@B^`"̣KHf>IJo\Cp(I<iqwï^h{?`֟1'7ՐH5mMЦV[^G)^u(n1Ea]0#j^O"=^U[x湵b|sIGכxh&2qidfTHB,E\&W#ZO58l)3;^+Ja9Nߘ |~/t ?`ί8&z?Y{b~?Z`Wz;Lm)0"l!0LDr9wo"ྲBnşZ4%/B">o36"-b/n/`1# pLLWÚV"m`֯yi='`vbj EOSQ#e3*%f[iFk*!^,!"f<."غ>#Y°UmQ7y15e\ol%X@tKAa<6VQ֐,Fy1a-#NwRQzɱ*%,KjsTUf La*?֥`5o2$Xm "_CDq@rjf+kKilp$}V3 #?kosysTOC) @EU)eH/a-+ttV`uL8b1ռNVjI[ ϱ͐+WMqZYP!qćIIqA.iVBn{K]WvrŦh՜[I +𲾬 S-j5]K XfXՃYke61¯{ߛAiz6.Y-PIw a* t"\Hj!@ :Z̬pG ף-=*2RZJ}XzT-yoCu qB.0isT)<Cgbb*%0 {;Pxz깸|mrƠ<?]C+a'p5z0/Pt?`qX;[ N;n ݒw΄ `Vƀt}1ECU!u18ڨ'+6ҼDw5ݺ.xYϢOCwf01݅Mq[|gܬ~AN3n pQZ=Bi0 L+|ĉWtvs.b?g5;x'62""fYK(qCf;l0t_֑k_Y'z '{,m3S Y9$~J.^>\t,˥HRK%|ka$ ʎ" Xu[tA!6:<;"MCʷ%uoP/pִ")\}b;Em+Vp.G܂v W0=glX$}+-)d1*Yl/l\'}!XCt? 9zYe2R)8@XD>P!Ȕ ̾zs_jAY +դ|,zRY7^R oJ7 =Re@ DC~ڸ)uB zuBN=*jWE}X֡s`)c_j15Vk}–am5PZQךyمy%yO&y)CK6&y1`$zWPa71b'dIkK⁹V2E^qJf  =4LކBocQ衏Ksu|0ʚm#8^_-dwB'LRؗ =y*b;Bo#B 44b$.]x!Ra+kq 4°zOpH q{5is =ۯx|CY+eEIOmUyNSyX;y0K<|ߚ903yh}s~4<ð;f}/4 ՜96=?'. *cup#X4G>ǨmΕFQoc az CF+`lfF=%DKU]ZQSKd:_M2u L'ۤ3Ŀ^Pm4m.mXU\Pf6`ݠ﻽GN# jvyI15..zb^ͣa9l&l@Oc!1C|oo-{:wyf1ws?$1@hC@Xr3X!1@Yi|oL߂LE4 C6fxĶϏM4`ڭ.hnp* 4`fg-rӀ)gC#A6Ɯߖ+͚G:#"le Ya2Zm0^#$Lgᕐڎ0[H@\ToGHN2"l>0E(R/HJ@:KRYuGJ@s䆿Œz pKN0 dgH_fT4!h!V?YL-& l$9,'L9av-'~YX 9b†06&Ą?m1,0*yͮfSUz1a$Z11~acυbXO1a[L B8jU hs 97m_ (%`Qh~*#sq+GŪD5󖌚hZoNŲiYmoT๲}0A99-/c"#gǓ펯&Dgd5aEјߌ|>xo {p$T>AH^;i$4ǘ4ـ}|R &.D B Jk7;TEX_~{x7~]`.I*gӔec 'nZ * C~αdzJ*zOǬ3/T  Wq٘1H!t~uP_{}8%RcC:HR%I?JaG&&3wLQ;` ycLq3H33up#<@АVoPkXsøԑ^TRss0A6Lsܪ=p pD &]ŭ!k# rʉAdh^6B >dK0MfY&?:esވHkb#Q * s@ȻY ^_gWݹj2S:U6;sZ C}3%s)gpVlPmՅȱrPƺ*ǭ\67Bwa\׸FI.xt=aJzd j88s>tD̞Zth M L;YnM$ 5=w TcpA*zz`sp4b=qb{hz3l&|,b:V^[Ճa٪_Y3Cķ%,zںX*>g6c MφgcAq+75=IJٽ9I xD#'봂^ f.t14= 6C>7g0Ig8˙jt^OxЗ7bcT|3ՅԚۅ#A -Ѣh'0ǧ/ܿ#]4*1\NC L`4@,zHtJZgJbۨh'0u%j-Y!fe#%n .R ,8FE}Ys61UbTgTN`h* XvfX"FE;NeczG9HYӈ+1ѦڑRڈiС-J!{7E0AvD0@T=]a~ ޤyQXvEj8#YYi ժyQW"l'avrfh4CU7]xS6nXG}0c'@+@]c#NlҮX-ꔵվ˂>+SiZ l-F?\xX޴ QJ7- p5Tݾ?a*LXUGuSHpE.Fڮ[1R`zRyH\G-P 8 t.Ϙp)dY.9`ZhW(T2iP2^a|<ڡvǡ_yBDz8!ۖHhucibl̓R7D#Էt&m6NRƠG.&AL q'8i%qRi/ǐHK~ N]: m&3ƅAOWuvW];.H=S 70;e*jpfA(<-ӔAݱAf}6ې_MuCb/hqjו! L ^@9 sOFg84oHԃR/h*4^"1ٰ+Z@7ZOgRatn@D pM5sv`SaFp:%8*SMhyR>JjQ;/-t=]<<<.?>#a:Lb557ٔF YFDfv>GLyۯ%Bc1ۚݦ"~8y~8c4Qɦj2S$0T@ܧRl"k~A&+1 (rC#j0⨗`(^>}b?J\PJ:肉X&C0q` 2Qh#R.@#P|Aѽd9Hؠ1f2yӃvp^' I'.e5JN-3a }_S.r5#Q^a 3f(Ef<*`Zj\oX@h1.iS! ].s9n9=b']o a#fAre51ymJtΰYZK Z zq)ьn?-0F?Zq#[u+s>G~8ޑJWek63<]4]6)[0( {TEI{h&O <K Q<1Q ?$᳌3a{[|[3} h@1g;yr=0ۀy#_̹/9֡/*%yb4xQFGey4PrU`Zi1eJZܦF^zu9nDlAG-ޏA5/U W(W!5 )F+gPRYd $LgXZV-\_q>7~\t権Df(w"C"ױ5PQ|(9g|jؔ')EKÃ\mqp[wH3 :r3J&aa/K垷mR3i~|t(lcG1ߎI$V\[pqNDK;(*3+WUx?LMF9T#A^s8nXYց`$^Ǘ/u՗6ޞR/C%v/8fqoڝ/`I}*̝ͥxG'Z<ۺr SG+Z>w/t'݁x LrF>&2,A:(28^y7x a:}֋ ]44I@BQNۓTަM"r,]^}Ki $zxjΤzoM[E ~d)#DyUԴ_U_|CKO½-z0 \\d1D Y*b/Gbڹ_ hP~VϭxA JЃZ1RDƚN5a]bSHLU>xT3a 3TRߔƽREOZՓ{p)O"`{eo,Э("ZfX-LJlUCcĘwjQ5LJP;:WЯ j.1PT~v Z& /% 6-@Nͥ- c4ڍIXmfG_ԬiE)8J _4ha#5Zi-`hfka<nq`uZY/tZ@0KuZRZI(FHş_B_uRhqG0蓺jOa+8IQZ\a j.BB>Z6N)?Zf3\>Bح!Sb<\CŅ!G/5,ա@hFxLͽTlA_npwt3Gj(6-=4\)岱;!BX*؀&xSF(u36#>Ծy#Le]e ga%Ncf$6S[j[@;*cb!R^Kr{3՞D`u0_St2zf98QoOmٶ'',ےD 3 I|[&1I0\K sL"&yaX:ZcEOǥ/iKތtKn1`f/QNU\:ӘJ\"& t{ l)wa;sXDvP2"rsW{(wGnJgdC.qHΩw_pxD"ef!COA<['DsHl҂Xty~CjTiXt.rEi 2zEU&l?` 6l0|ҡ-HsIzJ *[^ǩq4"+Re )E X|UKvcu-8rV.)÷*lR!XTz"Δ#T?Ǐfx&0TH>W+c|J)`g G;"YQf! `Lb˶TW".=ltZ*Vܾy;OQ&4Gܻ-"W^zlKDq-wYW",ooS8R2ޏ&4o Y@V h+>_lE+eŇ2'%Y^dLqYLf$N< f݋DsI 8D9ZeJ!~{i&&B:Dg|0ݏPu\6ք/$}b$l4dN\w2rBNOf챐5 \'ѕbtfOZ_Ix_v)ifRj3T[x(`jjuz[zH7bc$=Iz`/,K8$=awM9^tf6T;c>kR͕l;kjd3\o_xa~}(*,_ Run.xȶ۷` U^Jd=`+;݀-w̘/ YQ&[̥--S j4/i@$2s;:n@UnɀP\\f,uZCrabn4%dDb/0UY2ϴ#HOL~܅W_s-R\9i2 EbPT!->BI@Cү.ES%3xS(M\7=o 6E~l1R&o^L!,gWRVV|ȤtE镂6:!ت o1έ<},c1[7@ x+OϘyH;~ؔFy]3` LSL0õ\*TvL?/>u[:s +|j,pP0>zgK`z0GV? {)0a{)axI0'LޥZ?WGUw)`&lޥXe (SFޥwiۀK 8^a52f0r ks)0 up۹PΥJ@\ na(y[fKGJާ\x':3?M[QA5˵4cV]8M:h{Mr-J]ᑱC]KS!]Kx w;yGb2<:@ P"tsrsU x6Y'wKe+h199˿7~%L⯖'B'LJB4{, 4-f=s4jS-;g/Y^+#"J `l }iAke (ٕ (/q_bP>K$TɥOglr|xGL2Fqhcu9 J 5[oNc=nL2N2y$_\c DZn 5Rg:? L9_ 5fwś<5iLf)5f{Jw |G.NmBgt*_Pj$c~ʡޔzcLlJ>"{MR=/2/(>D3{+HqLM> XCnlJRj) \o[<8#g b0m'Ty8|.t޵E(Aݾs{4N!> `PD3P$l]gJ ؑb amHXTD &jAu @ CѬJS&DvL 3{؊Z -FsZ*q$BU@ck[$VXCdK ѫEJ瞧eB~L'yELeΤsTCja h' ;@B!&P0}<m)Wn*tE_0A"eBh2Dir"\N!0 7"!6tvanE©U߉{)P|\'L8U8Do"/Q}#ǿ dZibd33ʑ ;9&\ "o y:meDUZ(}LI ]dX/ffz٪/'/`^z|eDW=35PG|`jz+^*S ˾6Ce3bzns+sտsC-aA)䥰VZXÎ_][B> #ю Gj2A&SedOgPsIl灃1=ڪ&0~kl{k[vN=-Rf px>q"l>N߲͐)Ȝ{o !~|i8AՁX+fzM:aSAbE._Rq})$gFrRg 6YPph}21'K[z-r%KXψ-&d2}KCYow,+#@"nC7q~[q&-V.[W`Z"nZ q;"nc kA0nuD nsbbL&f"nK&nKIu[u['.fU& 6OR7WٴkFef n1蘶omYQ8Q^mЦa nVmߨ}usƟnn:6u;`Pu[2n궜PAݦEvMHmn1oy_ԭ)Smb`ʈ8FXgID @F3[f(eLp}D 0Qjq;RwVeӝghTf\5f0\*&\P2l~,szVbh}쯈Q^\ X)fjXЫasR b"\dY+̟<̾uZ 8yi<*[ܶjȳpŵ@X9p->³=,>&F c| ݟbWG,aY̕.ɳ8,8NVH~T^iKQ8≨p soByHOu`H+>VؕȒDj S:x"8(TFbr[u1Vn 8uulǺ~1 BM=\˕r \H!yi-snoF2.T|8]ouA6lkjcbHN1'L H  9,`2>[k)jQ"_m*ۧJI=+kTR$aك*y,tpZ@pf j5ϒZ ԧY{Mtٙd,a2ɊkDEV>GA;~"4H?ՏS]0dIP0B/7yZxbwzRځ-}XHC>eWs-f:ONb5\d˒"b:g-%ND|dq2%ԳӢE-[!oч:胊y{Ll44DP0"}Y򩝵Cm'1-l%~`eS֯N;&1Qr;O5d%v#Ò>d|ҡ,R έ>`櫒0̀W6ڳ#m4$L >ԟ6ȟ\umx@oiPvi*SX3`p`)`ǖ~aR#ǚi!NY8kO?s0ޱfc2hiP{')X3 "xSsh׉5Ç⎅d!S}ʰkV[ |jOtV' p9֌(9֌O1uK!c <2USFX3:f܏c2hX{k.k틊CSÖJ9ИxKB9،G9fuG[}u.-;\uhDAn=joBnC2Cֈ=ἱ1{ /Ss{P+rVܚe7Ɇ'!P?N E^C,pYc|oğ?bvDbY?Aӡ?[̽}1-xu?L}P lLm9]5T?_N(&_yT a*%>»+t>MׇocIQ44_L>K#\-weX_ҸKG{H)'|Fښg,GۭRZ[0fk3o9TLMI HieZrGos+-,^MwQ*- )uGl:ܭU- R.*GM)G!-=[n:h-m VQE)I^PGI* ]Iu0w*#h,dͣzVpy F9=黼V0"{Bf"C,`XV|`eܘɼJn1 \h0{3f0mA%j \zZȺAT:|Da-vP7xQx~rI7{8/Kl6qy>NX<Ì%:AXXH-(qaG ZT0y)&ysҷa2ELTqT3Ԡ| 2tMk8QE_lyٺ rRoPPnեC59)mʪ1m3ܹԫ MvI_7@)mc2#J`7s.GF A6;Z4Eq BDE4Oݰ_t%B ˔> KJjT gAc0LEjWӣثQ~,܌rG >:GǗ/6Lտa G_/ <hmXe c&/IՐv/eӉ'a?L3enix &yT,Iae]:<Ǒ6#MJ`s(!͗N,T 4ιmc^6G,TDt91gs&K:1W t\x$5ֵMYNtw zHd`PAv-7V~00pnС*V#0߫18d"w-&sdƕ"{A{Vf:Rۗ+jqǯ3"fd\tc"˵~LQz]So=mR7 ??a!WblBh%9(T. }^C RS;[~420r$bE{ s`<RmLca}WmZ#` Z:ʺT gdS6ណ˜ H\m={mRp@s!aوwgx$/1F>gkx0' Ic"N\I.OҀK={a&2N of| vt!2ywLS&gXowbgZF )n{\Fr^8ޓe3:0"  ]QD̽)^VZ%w3˿X;o.Z<;Mg`19%a)]u>fKoi @/J>4ec˞.acdxvq30vEHDXQ>`s0g -~UcQLG z =29+D1O0v#)*' daѥoP #C$㑓"}l>]PqJX"?Zl XV-݈#F+x#lIK.n`MYzljC@\"BcRKiGh_RH >8U:g 2^`eA##^1)6dx,?LxOzif |LĵH7J#1J5Cl1Kċ7J4ȝ}XW vN"$@(>L< "  O .`B&kJ "e Y [9gZ3T]s0\bq|!C u?Ӧ(7ؕ+g^bX#Oq<9߶!vT|0HLeD;P\H?RsX O^ _h S 8wH8$j_{(m$z_XkJRaSR(x|@% iSI|<( )4:,c2ZGW~!:E#'35[9p6bH+#މ=)$uA=C8zx_R.?ԋ H#\suL\ctU\ĚEb=eqd:0~ӢoE yђSkH-yc^6}*ˡ/1$) bnb6hHd _Œ3_pHSF%0>q͈݊ìj|}ZM'Nj(ڣjcL+a^Cb5Վ)\won.|& o`ӺiVkcg>{wLô?y!6CyOs/&{Rk&OK3"Z8/Lo}pk~eַ+o Rэwz!W/jqR~~)0-^zzZ~Lo0O}e2̐kHI1$[)~,X`WiCF8P5Fߵ[iTߘi~s_v6eBqdGVql endstream endobj 6 0 obj << /Type /Page /CropBox [0 0 600.912 861.768] /MediaBox [0 0 600.912 861.768] /Resources << /ExtGState << /GS11 12 0 R /GS88 100 0 R /GS89 103 0 R >> /Properties << /Pr85 99 0 R >> /ColorSpace << /CS16 16 0 R >> /XObject << /X14 106 0 R /X15 110 0 R >> /Shading << /Sh95 30 0 R /Sh99 34 0 R /Sh103 38 0 R /Sh107 42 0 R /Sh111 46 0 R >> >> /Contents 98 0 R /TrimBox [0 0 600.912 861.768] /Group << /CS 16 0 R /S /Transparency >> /Parent 2 0 R >> endobj 113 0 obj << /Type /OCG /Name >> endobj 115 0 obj << /Type /XObject /Subtype /Image /Name /Im66 /Filter [/FlateDecode] /Width 801 /Height 440 /BitsPerComponent 8 /ColorSpace /DeviceGray /Decode [0 1] /Length 42326 >> stream xU5~;;fgf@( 9nP  AI(*ID$G&t49Ge[o#**D~{T!B"D!B"D!B"D!B"D!B"D!B"D!B"D!B"D!B"D!B"D!B"D!B"D!B"D!B"D!B"D!B"D!B"D!B"D!B"D!B"D!B"D!B"D;4>|B86| B0*c QP:C| 93|B}!BdsPeD&|,B2 eU(ywHBH>!BQt2KF)D* e ]!<PC"e$J(} !$JBJzo|>*!BpwR `=>.!B@ BJBB* !Ӭb ⮻w!iV | "%-DC۠DB( f7|CBAUdޛP'E-hu2ق9+ĝ))iVAHw4@ vBBDLU:H; HH $?R;6 FDfUH(P qD!)%_ qF#EB",&‡*ĝ!D[a^ R!ǿU; ""y)>Z!x!B0J@ҬB" !RV (g|; 1xZ{")IHHsw",B4]ҙBc=ĝ!9͊"ĵf;DBICDRLtEB$}H; "8xC" rV;%u!R@zyiVYaw @"gVެT͢Hf%$]H;!|!")PP'^ƨHs@H; fЂfI7{ⶏ<:┳"C"^,+$)w}6܀HgV:Ĕ9m q$w&%")'$R>[86!ĒqSyVYFHBbŒ #!n!$ D X )@Hbƒ>!n_B\,KR RsTDJ)L]#g. B,!G2 ܹZ=޵/ږHr!nSD8O\Q|Ia0TX69!~W,;kIv@B0Jv"$w.!y-Cx-!4ͪXDB܆ɁisHkxJDʔ D%|@C^]3ߚMq RyVbf qC^A2$qu'*juDHŢ@,Dr(ui;)*zR+ >!nxo-dzxzba*m$7"|_X16mF\^W""ΐ= B-!$N1K~K?%YXO T*0H B.Q,Y%K:y.(%R)1׿ɑ#A$ z÷dRR+VT6sRVY!V!"ҡ!nZ(dM"Vϙ3޸ݾLv Zv#OHfrCqIY~99 'Og-'pzQ q1!4R>!n',.˳t*o;K"zd R3,}"+C|qS̊(gJDn%)lIwͻ|9*)HAlNDv8^;( ]LhHL` q@6 3P;$ ]PU녔ED̡҈S*_py'{C$HżYC!B#e0R$g qDl@b/!$kV=:&o_t*ZNBDϊ6F"B7M1!n\d^a蔲t_\Xd) o zzw1ai$e˅VA ?\!$fydgy) HU3݀RV~ D57@ B*U*`c5gqa%Kp"y*^YHr) kIR=׉+cY_x7١ř#"<[p0įA4R&qDgnWPD,Vʑ}(=M45yZT{=d`ßn0eb.b)O{wX3AͲLU"y7B"xMC9wKHgJs@A!-c1B$ųy?!ٲess˳\F.j`w܌d-U8`ʏ /bYJ$/S"E[֔F|q 4bHRY=? h=##(׋f#-b`<7q*gU+" q6˔|!~-PWp3Ŭ~1+7?' Tv/~)3WB#JėQȜH.hui9#rC:-cZ^J 3h,YDպaOR,GGVZ6ղŲW1S,JE"I,Ib͋1,qgy>O u"3!'OBRQΡv ` 1QdE̡52pqz#$u/4C2U F8Z]B bbBLHtH$!8DEtGPX-bZŋ~FFIL ◈U|@irD*ak@Cbg\odִb lB)G,_B_$O=U e1HgRŊ_,Dk;ĺϴuσRߥbl*ڋ?/՞ (@A?STK]]#VG)L_m!F$ 3GjO?4A9" D+V,OO1[\c. xDb\żV,EB )b*F%Y " d<["Q䏙u'GͶ Y E @'Dw":REˆC'cnFy뼊VB᪢`>!~Yfg R)RH!!"C1d(􊾶5}/Pb3-'*a07hV60 I(oY$Y.k(Bb?u`FDV4ou?@!5jTGz;x{dʚ5 Q,⟗qŲy? }O|oD7%iyWRs|b%HM^y@䥗6l< $kz5hTUZ1A+5?фMļ~XoI"pa}!~d4mڤ  )vH(kh;&B($T@`0G֝V=#6N WOu^}զM 1$aZf̳3?I(ݑ3Bڹփ+r{.Mv^$[8D͛534Ҹ1bԈ`ZՃn*UȂRAB]"\tZqrc9@Y^FIºRXp'^kѢyW65$V} рU~/a*P$d*!To>&(Cε`$'˴x Ch굖-[B\1 v$؟ y:յh˗F Jڪoqܾhnq[zSb|[A+"BI+mZH&h{:-B%}(OjπVVnx$`Lޑ\lB6ËVn/wn@<[#YtNxYqFmZz-Z4`rTêE(=xX$w$1-Bh7Fɖ=k%%OqѡC7 DLe0\!ju_V-^gy>WLu%rijfHe!ݫٖg*o!GB@*U3#!+4сY *dZE؁&:#Ca=+ȠJG`*kC$9#NY+fxgy1!*]2)A 񖉎ovx@`ʾA`w{<6bR!RZUu][u( 3; Ϯ-x08 NhQt2P }n&mz% v_~%(iA lÚHkU)ngݐL{Y|DUeZL# \sEĝjw HtٲJd`e qxw"o)Үm60jټYSfF#(Gnx<ؐ#O+OBB Ċ9, Atڵk"C1i e=l֌FjQt M%"d"lxl1#1d+bA{.ECJdUHXJ%!Cċw1ZbH+iq`䕗[A"Uk&&Du RU{3O!$G"K}ijLm"r՗DRK[$-iNMK/8@q(ZxN<b'3HLb\~{]<$CqR*B@Ra w||6Ӂ"#Dz\N1y[ҶM֭_L ZXV;5_b:a+ C!a~jެ\Xj,2W~3cZS-W>!RTzէ=SfuP tGΎ!"F ڵ"F:P vI7G4mJ8i820F|IӐԠVb`ggi$d#Z b:ɱXY6{h1t#iArPt팊F`%|{qj'K]&륗HonRGek#!+!ye5Z߅B e yXcaƯ4yQKg >;6Ő! hb@;k!\ d\-Ob!q qc$ 5JdHe+k_˹&d)kDHBb%\<ye-\bQ3cȑ#3O>n 0IOC$G;\ 믽:붰I ƌ|)BCəZ>JFq\[hadn)DDH!*2/@5o-ծP(kxZ=j"f@bhdH}4d AH՞:d>IsJ@4iyh _AGc}ç\GltW5t9N cUzXbT Fi-^{u-U/sŸG|1tI>4h Kރ-2k V7;nQҪZR @`*hxѼIb]X5nJJn8$2˶\B0͢J/Q[B*jk4!rcH6m۽ѮE'Jd ̝_7v ӈ#CHi]w>o#Pcd\[>Ao!,Ңܧ$KOHّxc B/tXFB-cHokb O'L?n̘1##Gn 2r-T$ 4W46R \2fp xO9} FH@HvyP,@RLR!XlB*F_ijTzKHǷjע {I' 9b 2iӁ?b_!G Do0@@ ֚0~_+7^' CMzj! :ucVlK+zIжBʱAǻ!X}Mh"]:ݮydz#ʝSLd0 \닡 2Ndҙt۴` %X h׶|ZWv2;0-c`)>IeAHg(Dl2[wd6 1RX6oI"=R۝ysv͟y/bSLa11C#`D1__H$ݻJ!Oa   'owيE6oC㒈lٲe!h0.N0B b9VgP<_߈WxVB 21yϼ.tj״c 3gΘ 5B@"&s xgkMY})&N &'`Dy~tPC0.mB䵖#guƛ^ W B+C!cAthK YBtfk'͛5@d̙GPjH$& Q&q ]%}T&AXy |߁d Bռz !zZe)W,S B^ket:dPbb^ u7/ ]nW|,ݖ`"_er&՚6uTk>KC#cnj5r %CEsVpEU "JU,_f x" #_f76M\k(`H(AE̼>}$ DjAr),Up#mA !$"ú}1B'+9YzBJ0w;[|Q;["wxnXbe˖FHfA \ *[X"ǖ ¶ɧ!XVP`ehP.X:#XT/Y(yFcsx:ݣߤ"MZauRYJV'vB?ί7._2dΜ9<q2}:w' |%׃MeEE UFV2(M2p͹p/pi`OpG#pH;N26$*h!$YQmQ!os\'d,@pQ_|>[jOG֊4Ȧ"5(HK% R:%Ѽ}uNPSc_*_8)K:󶁂ʄ\=lN3ձy",E6 qF]&CB1;Z;|#ݨmXĐ!C|NJwxnH߲E0q#2IukP&p5ɂl[yG30'MB`AL0ডQHe0R).p?aja.J9ٔHqUʐ--hZ׀ur "o2BՕYXRKu!B6lHך ޭ[#H6t v鵃(YL-L2T'̺L` **TbgX*t{ƳB]FvwWEv,#9 Hc"WɚxV&Y|S);9E^4-*B+BF6͢qHRyY!Mv9S糅Vm[MoIKHIaF %jP% JXp)ʄ T}(#GlP^1; qQ"L“x:VY3e2ڎAH$RWo!}s-/6 (z;|Y{ibTfV'9j/:Xc;6@IR$"ܵHd BmůHt Ch(E/{)LXp:oqZ}LA(&^g܆! ."]uÉ"umE #ID;"`2!jPZe =v̈^;vرbR-ȶ6oLFE Rµlk\7\\s6 T'LFzEmROe gѺǞ=ejw;D"㷬"R]eխ:D}Yjϐ={~"Oe(d(TK OMw޵s'b2-$D$Mo(AU0ak Z.r0d] ^3Bfzm$!#Ç`چ*{sӝ-oo7j D {YDdjXEԫ'^F碒Nլ.džRE,a#F$=>ܬwϞݻv!FHIHCi+%;XRIJ8`210dy$-?2+*zR :!GI7^(JHIE-3&=yĮW֕ڵYH ΎV&g-B6r"UjY"^K2q!&{Bf}F$wlgݞ&nJ8"d ov-^ɗHzqE.2E˹x^d )Hˌ uJzi)bkfs,ѐ^%˞$6!Ӭ&f {O"!JgDK7^/Ǜ.o0d J.Y[L0!OY@<"H9e\{D, 0!0`MIoz%/|ٴDkʐҴhaR"DD4jo m'0ew"ea- BȨc!L4i-,:'"DмHZo7P%1*V"χ@Z DȔӦcpfÇ:|~G S A&))&"PPMu|A&eD&$MS%^OywtD;XE>/+Z~MYl+?JJ\'gY11A-B2jH]CCp5 $PBZB$"#}BOG&A(Hp߁̹H=dߓL֮j4P'ˈM!U%I$JÏE#uoE:Fz" 2>k Ckg!Ppc/xd{~%@1Ba͹(oq…81D$۸n`nGR'iT<օصу Iy9Q.D UeC_wdD/e#5/3O47 ;,DAp颒8l_QXti?|?:5QG}" Cdݚ_4Np'pue+I?߁ w$\*N TB~T3BE[(k$x*T$ngw [qE(ڬK>swD8kU`iel=qabaGZ%'z*"!,EN4o_@>uXIÆQwjZ㹪5 `Ġd挡9i !$ d=j"m[R\C()Ը粬,MUEDzp*H<P" )]TŰa V uy1"I$pO k1P= BEPtC"<,kB!#񈁈M9u`g+ /NRDN@uQBLrf sG!m[mUQݞ21!N@0P9,0~j쩝C`DcŊ&FE $3}ҺӅ3DEoL(,N,(;% t("M% ‹M4HDNV>WE LĥU:1D1-?CVݍYzŐC*O>_*gAq|iɣy\&.=dϐ`@% qɭkё m !B뉴 *A/a3-LGZn띏w IC0" u6:Q̂2iYYiS.@lGpɡG?p@%>. hUX<!%)jWX_;X(xȄG&OaJz-2م`/Q4kϔNv o--i0$y]ޓVKU.q<+s t\6h EڍӐG~ؼZ" 7|\X'8oXiEz FFlM=eRӂ#H`YD:~$4Ί"3͋Ws;w9CU# g4"E丶=D"tQo>.a^v̥TwHLd ,c?4͖!gC@Z28 /' yr)4+:c3-#=(@#XaB]("/$87D2RZF"_D͇Ue8_xoTAd 풜88f aﮄwR/iDh@bT;SxLD& `ڤB "dCt&"d6 V-67G}DgѠ*FKw6~ņ&ޤH6FpGP,bEdzD 7g`tS*1 |]T'wHV, +]?ܤZe2ӗ;մЄҐlCqvȵ\= ;t\D Gfj!`wh5lSa|eGfBt- #{V}ɂִE4,{xFd'H@Uhj#)T5RS,4ZdNfp'$(BT6!2qK 69vh@᪗];,M6kxuo4/y\i}KyB$ݨPRL 6P[̘IW\h #Mɪɑvz F е\o~l(!CK~D ,5} ,]fBI^a G W%gؽ#H)l v:\ivFǪ"{b:lzu2%ݣ";T`**xא,X.o#EA,K. ߚ>wU HL{ i?'7OwĈ _rMP1661aH_dނ ֗+lڔ9mݴ1?6 ]W@PD;DX0Bmrp$`SEۨQ*ntZ%D a1/~ yLb03 fh-JF$h?l)Q۝`|Viw)Y/E2 KZd*,aI6lܸ)esZږmյ}{Bu$g& D'x?`Q<3F8 &\6KW޽b^Wl/vn^pF͚5^]܌cn:bNp(Q [hG#P1+Z-DhOZY+! DCҷnf|dM7epaxh< ī;]EGğjq/|:L˯rשxy*%Z[RTY\aJ҅l".*+V؍CD(*Tty';On͞5?W6 #uiȫ}3u*GDB=$D%3O!E@D!fCYwe^ݷwc'N|ܷsp?\&9YOpctlʼnQȚ\n'R),k,B!^V5k׬Ne),K,my]IN L=!kb4!ZԭF&OCj5Huٵޤ}( Izn"q%n`@d&Z0,2X$5H!6n޼%};!{COmկߠy{ǯX.^ @04}) Xp \']?W |4b:g[y}#鲸NAQ&ut ZBMu !ɂPlPVm9r:6/Vm\zz^v#uS\uLC4jt ю_* B%bk&'7IVfe b߼2rѣN=oӺ2i_Vퟒ4dW(N-/rDŲ.mfn焉{fo>KZD5t*\bIPX9?T^P4cδ;RD!Ղ}AhjڬyKL伴3hr-\ܒ" uᄏkϽ_axp4YmwtUJ|KZ&)vn-blTO00JomC. ᄡ""j^7n.< wz:խ_쎰 iڄpkPk{ ; . dgpVG#VN†"UʲB-n9->[:osիߝ;7Q@4me^!8"Q6`XDEo]PٳۙN[w.OSR&,Yxm _[/ T)nM$ܯ}ewݿs e)Yno-,hW"!-Nc5WsdيU!! ,ȲA}r,N!!TɣiRf ɨ6-/}oƤvxw '-t1\EƉovtm4mxq*q9ɖ58 wV9`b'xJ&T>Q^mʵnZ-WMXuݐpq"`.lYo/ɭAصR9^ R6-<x>V0HZf#wm mlK$#Vx>I}?t><1`!gY$k4S7taQ!btr!rGwoٴv֍˾~Nwޗ4}P7ۚhƸX>XDj/_%ޒ޳g-Y>pE)ۧ[s_rG9qMasg^8{KWozw)%cqb0w/sǣ^G!6rorҵ3ԕu1]b%f{D&k 5w!8⥽7N`r4-9z`-^!4ic H "hAJ-'Nw}inL$eZ,X.op /ǩ{ydoW]orq4o3b;b/n|NJ+k܆_fA xغ*Ъؙvޔas|^A#]L #E>/Hq'Lr/ |HPXN6d]@pBe, n@?hXУFؠ1'N ;Jt\21bF:^F[%`U%Mu!R p2cpN;ϵ`.CH{ K)m${RW=yhom #F(b5j4sȴ2D-unK! \#T=qɱX? q_/] ~ՀN=wwWcҢؕ+.DN2HDV] !jRSST3"vn`AvzNҵ^sN6;I_ep2zXjU WxI̮D> =vUNv-IzSӘfX˂:{ANfHJ*6{2Wzfz %kį[V]W=?|r{ iº{fŬrB9g[QƏE D\*tYʎl}ܱM,yɹlG]K4PSUw%9 nRc§SGwZ8u{bg@6GyISp CdAK9u ɨ.t}|.Jo8}/vXEH\|Rp98b\ѽ\]ֵͱ~"ݜˮs<`7:yE=Qٺu-r!DtI,ZViÄ$bJ< 򇼺[9qx fiBf4J} 0\ ZtlEcs+1#Hr.  RW-HB :閭?)ųឋ=N]c5R[E%[҃;} w]e.YtњѠVIlDxD+ʯ;%~tS ȅn޸zi C\Q HP7ͥ} qrL^ ѧ)>@.9_'^?8s7G/XJR5s)#^\vl16qPvmswS.H;_߻Xk_ܬ6zo޻3  ;0c#u?>Pñ3xbų}Xzn\b)+62(d5dcJ-R!b6q{t!+B *2e[0^qK/&8b=8u-1T|L?zKNXM(B0({˩rInӎlOad)r9w'`c-ή9g,H hCؾ36Ғ'B:x(R=}Zs磎^ zL&pZ˗΋kBEn(BZC"\+cuBpc^!>2F 8",~|HIRQ®yg#a3z݇[;vp[՝]MR2Iv.W*_O  p~jw[~!Zwk z'N[2ExzeRҶB^ МN ~J<&d839.z#_vO6S>DXLHɖm-:kOEnڦ(I]6477'FZfZhKy<9n &X%"ݰ>C|+E']}矻P)cq 5,-[zmn޺c8|g_EJ IFS|m;Orͽ(^77aS:l}5k%K[iVN*K ^66J6WxH:֖5O"߮Dǒ~6Lԥh .iE imCgh`:op[:,[IͰPf}9=zxd_]*1KjJ׹v7h_Rw"ӣԇ?x>z˸tټ$L$ iiH8Ic#fdD|8!Ǖ%g)B?q:H P!\KG_z_nrw'"5N[[9Ep ٹE8+p)HqwΑ#ǠVb^ as-I-@,Jx[-l>چ)mǾͮ{+3&PTĬ<`GjKq>*G/?8?8䖑3£ŒLJY?I LuOpVv,]d--U7^Ӷu&\EF r{@t 8`.޷l$ ]:8THstGY_m=G6JSN+CB[7h;D c RZqǎڃ,t__Ѓxkn(qК.~  n0y;EXl -Voz^W W;b@eݺIIC&'5͔4.n?Z`Q>@8DtU:[jOKs0̋Q9bq+r/Z؅&v*f +1.-}EٛrY B?8.l[|2r]/pb\_@R۱p<9G;jᠪ~2Xk. 1?Y-OCdnw&C6&*Izԏ&?a{ Moh'5E"V[ }$[m2&zMDit6DpaJcBo"*%q͚UzXe5D΁[ɬӦNxgreQy`@G|՟Z9ՋNܨg2ZXJhd76 /^3x5js2ؚa>A48W\ zd|iOV7 h,@\6q~\'(Y KV͈4'{dM,9_33kS8e2]~1~qcǍ;vcFQMÇY_ 6 O7 4b$ܧ5N g!pҏ0[Ҏ֦ę׋9)t"%,8Ir?<~}08r9z8ڔI8]JcM`׹(g * " {\=$~wgv͏)҂).ƗJbxX!`;Y/, tDBt=md>a^ Da}̘c̷Q #F f0X20! L7(&׉ :N7T'39xv>|: "0nx`=䌒GIpjU?NIۼɈaN ʇ _Kd,Z;z|?k+ۍBR"ch3P|EJ?T|PAug mpsru[/ Kбk1pTy <~Z.qyO7ҕ2CO5Ֆsv&- ǰ5T ]󷁷LûkSz o~s_ᬞ7/g3p \ZjNVS]*K\Kzۤss) v:4R]cw{by3NTFK`QnN._߹ABA=g%hiPB:>Ϥ2I&< ͨ 0|mcYA6wKѲ1JZ¹ulqri)ŏܵV8 Y|zh}N7AMJjL+46{9s5milH;4h!6k踸*0b9L*\v -TF;~`$Kgހ&5eaU`fϞY^]t뇴VWgI'70!rV;q%ZA79.Z~n{TA 䩓Bɺ )g -zFKacR*O="B֤_o [hU'_+e<4p;1:)v,GQBObn,\D!I4fMbDiY*$IE#i3},]L Y yiHI&ʵR++μ ްʎ}O0f1v:E8wIĢbS%AweFǗ-"wZWA7[i]Vؿ.{[n-ewF1m#60JN35qwX܄^z2*;g kY\򔳄N;v5?66^_Gﶞ_6ʋ䟲a [y\8b*썔9ҟVÇLܚkɏ r9rСyA^6L`,Ϋf+;com2+_Gb7eB$dN:͵xv= S KbԜkEqz)0!FbEgHdnM^삧Ex\-8bKVgΜStDZ~`BFQǼ\gO3[4h9HgILQDnLIeXhd>XHWxB1 6a9;Λeef;9f,vLo}wcM-l\)Ff+n/no_4HZ#~Vh6ɝb:v~8x`A;[`;.]rVW\E'56͋WvOŬ$͎6n1[:dzt?YLc HIb3X)\jƨ֖k|/5ؠnq۹/|OdU*8д NL1trVВu`'^k+ë+EMQgw7$TvM-;xs+h7ܷ?J@AdA[Mx4wϳŸƒҥgO8qaRǙ3{xş߾{{]y)"ysT٘$ D g;xC4#B t$=[,E#|v7'Ẹzԟ^LsKvUݹ+~SьCt+3Ӈa' X!8 ӗrIS۳k\yͥ0_kaXXp\uCvښk#ηmu՝} VǯW.^ٕ;nu{X;u[NE.IW(Q~Kzgs9im#n^W+:"޽$ILa/: `n&0RD_箄egw=vii^͕t# >?!fOP;j|}vmJ^$,r+ym;9[u="]#"Ǔ|5s]aН}y8wG7o.~%!k#ag7 ,ڗL>il})KF;)qXnbqS쵢9{I9.5Jy9ӬܬZHիSz@Zhm@^p8HFh@}6s:-ٳO~ώͩɫW@tVp'AhRJ||g>b|/>M'vYOu*80<]{^|'LPhtv^<bwȞ̝yZ.>tH_}$-Tp#s>w"P٪]:t_ow ji~# "I6o9aDV5q,R^؂>ٷy՜s%7pi&: Mpx&p`/㾥p[T맄^Zsn;HgNS1l6- d(Db>Licw,ݐ^lCl;: 5mfjhd @wؑC{4m_WYQHhv Ml5w1K+9vNƾEݿ:~w)A'?x_YxuaBTh.' A:,'XXctZO$ 4WR )Q}gEhFZ,gJuB8ZaRNgCRbiev0_4mTⰓ(a!TN߱}ښ*oƭX[&B䆺Ms}FgqRh/l^;oSnn삟6TՌr+˸ZE}]eE ۄRO5._ ~tv=y-^>{@>Q Nh݅kc17&-YpDL Dć-U>nT6oXU&՗8.3 YȮN/eʄbf$ZxnRB/>l73<̼/3d{^:O[ Ng!ϳgd?waHsCv3N| s`c Q4DǙ E1bv’,#߾pޮ^XWX@ y8ɮ yJꟇ!'!%L`ᄲū ^m-)R|\>}~מxɯ<05?˲<1c3-˲ojK7\vzQb0s.Z &q"vI-|'[Pe4(X눧fTv#id>$ t&bQNq:kGy\V8@UB| nBx1<Σ* evH)uuZR-}u)>( L6k~yı}]ٱnCm%q {*OBP_ F9ō5k%h@RFյP}[5+T-{Ȅ&pJq&E4.}GMqx&z6>&I'?/=@]/AW/ ?bp,(Հ&/V(86!NF?C~-E}Bs!u =wum[WT1[brkqaD\E.!jNx(ua'WG3Szýx k6hi !`Μ2e*e9Iÿxn~r=㮗m ~DoIUgͺ(J]VeyW߁ʸC 7>{ՈKxXΎom۰)IjW2JvPh! ޮU68"[C@YXo ¢n#qoRB j&"Wdk9f+m2JeՍ~EOWgN(+8iϦNJonpQd)㹶]tǒxz^­+Q#N(Twh~]C(_Q>ۅsgN?ݱ{׎MZ BMR%VT]s51GDJ3 Tټp̈%XDD&=B;W흝zrNTtav.b_>~3"'Mω'0BgjiZ.wȬ| mw+*nRjXV~W`;C0xؑ{;v7mټb Р]6ZZBj ;!ކ̣E\sL^(y# Yq@ bd42GNC+ v  l"KW_XT£n3RǍp_O3d]{ck6z$l}>Bl0)C<0gNwwoܴeu`UY qe9˫ T3!9$&}A"-DQU+SUKYu׀J 2+AÇFszuM ъ& YDpnIdvI⤾]Cm/9w\_Ĵb„4H !f̝sHC1ڳP(D_ z%ʽNٿc-׬._x֬Y̙  06@֗,;$a6Z+Jk;9ZQfH#v ‹P0 7GC})1 nW]Ғ#TDg+ۿyů@E~čgİw? -˸B oO]} D6^:}]o^_fŋf͞5{6bc޼`2 b,\5F`uudUU0 ^N ɈbuZ  Wg+cpͱ64WS 5r@pP8n*Ax|'w/}텯y1<ϼĸQw8n  ~>ltˮ9V8zkgƆM5kV/c l906棚b逜j )K%S FW+~HuYP {B V/9*B9f A"kʜb9zmW JAH"0rѲ3"s?>d>4}__Wsҹ}zisͺ7W/~x;]o< *C¼l(ͣ)T9Ӑ2@i9]?p}YƙEw!cU1vD336j;,5}@zKϱQ,B"u(MT iʃGE<褂<͡PϠ́@jҸOբf^d>胁@xgN4P`|lU'qGe5S30CC. X 9!n0uF];j*I!8&Wn#ůˢm9-紭*+|DX}/[*^ rIdnx i؀j<99GaYAWaVj뀓=r߇)yKc&@|e _y%痫4qڈ.ZeH~;(3Vx:˛T$-T,GZpԋ 'B۸,P] $ʣ׻Y=Y^KYNI -~{[łW)=縁< dEB7_$B9eT\ipPyR9zR5[Xv9co Ն5`# 3-&CTrϪc#s&t}V-LHhڑznOVJ"1]c,_M}U"e h[?شB1: *0$7 +1.&lsְWlő8Z U"ZNs6f7*xwIWKJ탫yBb30+4]aC(&SN!<@zJ??ĹGo|2U0ӆcqkej8VזR^򭥞A 3W=R4\F1KZ0**xJFֱW+'M* mVORy4ʖ@},U$,ޮ +1`je$d]//~&r=_/IU-NKsk5xM:X!ɍ7 WAgh_M2Va^Kp @ެbRuOƠS.Ap)zxH# &U7Frt nFeVķMXޭ*kVkFxuFunW*֥¢[+>SM2E0ʭ r:.[T>bG|TX!RptPs9Q!N#z3/18q}hN,X|C3vD#rG=*<|63xք nݢjC!!ckmj[q<$\7?Γ3O> XuL⼪ԻPBU04KLJ:w[{= ȠFX*ȕk՚zFW:|@~߮I;·`F| 1:9FoMhkFA>Kg7ڒN=,-HsUL3f̘> & + <8ˑ-@FRR7bS< *+E<܄USGyѿICv#04 \ f3頍aiæ8w}Ik-BA%P֠&kMBeh/V; *N+RFdD+o>q3gzwAͫ'C"/,*':fxڇ]FcZ͂FBf&22;PϠjWd۶b/=iZTL2A!ND)rQUm_ <<+Jψyëĵv蔜Y7C^o $Pv;КRi%L}"AC'yj,6ext4 O=8r%@%MIlɓID`w"1LË%%EyGuW9:?_kF36dAׁT. ө|B5g]s %C:[޹D|6;?-iƧLE5h1>Kcrz3p=ÃA}t1A=1k1GGڨ}pF[{)4v]c .;%)Wb4/x&A%J'@&4Hmn>m ~ˆ{ 9miiٳCWr| ό) 0l3cHm6ho ˸EGZ DEG;9[#&zCQu֯>3sW9%j"xs è8/91!,8g4Zǀ]q9x=cx;{?ң:L~fꂷj|^' k"lr޿엧+ jg p(0TH\pIiN t43H3h<::ɡv-`;%Q E؅Nݴ_ۍdM- _7-$eж"3X7%&p HA0y].|L&tGtF'îE:bg:|e~Ziɽݬ̈́V:uJЀ\cY@`AX! 1E<8.T2eYㇹk81I490\yÎZ{-=pa;ut~D2O)7'jnAfjjX'yM(/|G|5AWG-2<3IݡCʌ[*yeEHj}L^c 3?Gi/ |_xJ0)!!*M4]{f}Ud㿀h떗rTҠʉz|H$% {O=XɳdHt|gXf|B "(ڮY IŠ}FL-r_]yw { z򹲿M{}d %O?>,+[A"D9u<|0[HyIX~NzzԨa6a3wwVO6Z|ˮ>&DMKgVޤgGd")oڳEb5%J 591ǺsCAV |xȞp; pO,rm'HNLLKNNIII#(B0dI4  yA DZn2bFb1tI7do4}s|Mρs;l“r\٤ֆ7gOߜQ0.>!ѳ0HIeC$Shb`3Ne*c)z@6^K~gT<#H{qyIƒŎ aL0P0AP0"0;v{aHVqcot~ץ>|U7>s2pzr}?|p @;zaլrZ^ZČ.GBA(I0_O$Ie @"`!%FE7sM_S%/[>x$W7?G;v ύj'ԬQQ1d A\@!S4x0h5 TtL*YƧ$$w˨@k]cŋѹ  xTS G? [ߜK̲'ɓD CAX#nmX3 f&/@KHYH4\\He ȲjO<˂WE@Hsu6' jg 6M'.lVƿMOKNJN\v*.0nD):"## DZxҭhR&"Xňll%%I$++݃}]pa&8p8u4ݳ x47KhRSS<))Ѡc,VP`DFEcnu —$1#04ق0>S~;cxE!t`T_>>8O޲21IOKIMIIN=GTQGp3( 31њjqh"q<t'{1gkqXٙ|c}ڰb/gL*Ersp#E[ar\;gQ!D%3Zӎ0mkY"lFRRGjbܸQawr"h gϞC3joZr/O>bJCG}`|_#p8P DŌ82gU-~tk=Q&RH%,P<̦|<)I GL9*W|EC!n2pG%YR @b#F7rMwYnN.R+kZ ӲHxNk^bUʪŐ\8A޼^Tټ2UQ0G!Q1#c©N'DyиGlw5t_T)4OPN*#!PCE=b>!@HST>A]Spp!GZq!!D5Dƈy1#F/R2~j^PSQrA "?>tt@_yC5rdHT 4KȨ#Fwu9HHO5 syh(l¹L@ DG ,>F1 >!7c7 [PT3-sra&